Tag Archives: SOAL IPS SMP


MATA PELAJARAN : IPS Terpadu                    KELAS : VII
HARI/TANGGAL       :                            WAKTU: 90 Menit


1. Setiap makhluk yang hidup di bumi ini memerlukan ruang untuk
melangsungkan kehidupannya. Ruang yang dimaksudkan di sini adalah :
tempat untuk hidup,lapisan atmosfer terbawah yang mempengaruhi permukaan bumi, lapisan tanah dan batuan , berbagai organisme atau makhluk hidup.
tempat untuk hidup,lapisan atmosfer teratas yang mempengaruhi permukaan bumi, lapisan tanah dan batuan , berbagai organisme air atau makhluk hidup.
tempat untuk hidup,lapisan atmosfer teratas yang mempengaruhi permukaan bumi, lapisan tanah dan batuan sedimen  , berbagai organisme atau makhluk hidup.
tempat untuk hidup,lapisan atmosfer teratas yang mempengaruhi permukaan bumi, lapisan tanah vulkanik dan batuan , berbagai organisme atau makhluk hidup air.
2. Kondisi saling bergantung yang diperlukan untuk terjadinya interaksi keruangan yaitu saling melengkapi (complementarity), kesempatan antara (intervening opportunity) dan keadaan dapat. …
3. Manakah dari pernyataan di bawah ini merupakan komponen-komponen peta yang benar?
Skala,orientasi,sumber peta, legenda,inset,garis koordinat
Skala,orientasi,sumber peta, legenda,inset,garis ekuator
Skala,orientasi,judul peta, legenda,inset,garis katulistiwa
Skala,orientasi,sumber peta, legenda,batas wilayah,symbol peta
4. Skala grafis pada peta tertulis 1 : 1000.000 ini artinya 1 cm di peta berbanding dengan …
10 km
100 km
1000 km
10.000 km
5. Wilayah pegunungan umumnya merupakan penghasil sayuran, sedangkan daerah pesisir menghasilkan ikan laut. Penduduk daerah pantai membutuhkan sayuran dari daerah pegunungan dan sebaliknya penduduk dari daerah pegunungan membutuhkan ikan dari penduduk daerah pantai. Kedua wilayah berinteraksi karena…
Pergerakan orang
Perbedaan karakteristik ruang
Informasi dari daerah asal
Perpindahan gagasan

6. Wilayah A biasanya membeli ikan ke wilayah B, namun kemudian
diketahui ada wilayah C yang juga penghasil ikan. Karena Wilayah
C jaraknya lebih dekat dan ongkos transportasinya lebih murah, para
pembeli ikan dari wilayah A akan beralih membeli ikan ke wilayah C.
Akibatnya, interaksi antara wilayah A dengan B melemah. Interaksi semacam ini karena kondisi…
Regional complementarity
Transfer ability
Intervening opportunity
7.Negara Indonesia secara astronomis terletak pada garis lintang dan garis bujur sebagai berikut :
6 ˚LU – 11˚LS dan 95˚BB- 140˚BB
6 ˚LS – 11˚LS dan 95˚BT- 140˚BB
6 ˚LU – 11˚LS dan 90˚BT- 141˚BB
6 ˚LU – 11˚LS dan 95˚BT- 141˚BT
8.Jalan alternative, jalan Tol, jalan Kereta Api, Rawan Kemacetan, Rawan Longsor  pada komponen peta dapat kita pelajari pada …
Garis Koordinat
9. Pergaulan bebas, kesantunan, dan lain-lain. Selain itu, Indonesia juga rentan terhadap masuknya barang-barang terlarang yang diselundupkan seperti senjata api dan narkoba.Merupakan pengaruh negatif dari letak Indonesia dalam tinjauhan ….
10. Salah satu keuntungan Indonesia yang terletak antara dua benua dan dua samudera dalam bidang ekonomi adalah…
Jalur penjelajahan samudera
Jalur pelayaran internasional
Jalur ekspediasi internasional
Jalur perdagangan dunia
11. Keunggulan iklim muson tropis di negara Indonesia memberikan pengaruh positif terhadap aktivitas kehidupan masyarakat ,yakni…..
pembuatan garam dan perdagangan dilakukan sepanjang tahun
pertanian dan ekonomi dilakukan sepanjang tahun
perikanan dan perkebunan dilakukan pada saat angin muson timur
pertambangan dan perindustrian dilakukan pada saat muson barat
12. Perpindahan penduduk menuju daerah pinggiran kota menimbulkan alih
fungsi lahan yakni,….
pertanian menjadi perikanan
perindustrian  menjadi permukiman
perkebunan menjadi pertokoan
pertanian menjadi permukiman

13. Interaksi spasial umumnya terjadi karena adanya kepentingan ekonomi,
khususnya berkaitan dengan pekerjaan. Hal ini merupakan perubahan akibat interaksi keruangan pada ….
Berkembangnya pada pusat-pusat pertumbuhan
Perubahan penggunaan lahan
Perubahan orientasi mata pencaharian
Berkembangnya sarana prasarana
14.Gaya busana Lee Min Ho aktor dari Korea Selatan banyak ditiru oleh remaja dan pemuda penduduk Indonesia  . Contoh pernyataan di atas merupakan akibat perubahan keruangan adanya….
Pusat-pusat pertumbuhan
Orientasi mata pencaharian
Perubahan social budaya
Berubahnya komposisi penduduk
15. Implikasi letak Indonesia secara  budaya adalah….
Mendorong terjadinya akulturasi dan asimilasi
Jalur perdagangan internasional lebih intensif
Kerjasama antar bangsa semakin meningkat
Pertukaran pelajar dan mahasiswa lebih maju
16. Secara Geologis letak wilayah Indonesia diantara tiga lempeng utama dunia yakni,
Lempeng Asia, Australia , Hindia
Lempeng Austalia, Eropa , Pasifik
Lempeng Asia, Amerika , Hindia
Lempeng Australia, Eurasia , Pasifik
17. Menurut ilmu geologi, Indonesia juga terletak diantara dua dangkalan besar, yaitu Dangkalan Sunda dan Dangkalan Sahul. Sedangkan Dangkalan Sunda meliputi wilayah
Semenanjung Malaysia, Sumatera, Jawa, Madura, Bali dan pulau-pulau kecil disekitarnya.
Semenanjung Malaysia, Sumatera, Papua Nugini, Madura, Bali dan pulau-pulau kecil disekitarnya.
Semenanjung Malaysia, Sumatera, Jawa, Madura, Kepulauan Aru dan pulau-pulau kecil disekitarnya.
Semenanjung Malaysia, Sulawesi, Jawa, Madura, Bali dan pulau-pulau kecil disekitarnya.
18.Jenis-jenis kayu : keruing, cendana, akasia, kayu jati berdasarkan sebarannya hasil dari daerah….
Sulawesi, NTT, Jawa Barat, Jawa Tengah
Sulawesi, NTT, Jawa Barat, Kalimantan
Sulawesi, NTB, Jawa Timur, Jawa Barat
Sulawesi, NTT, Jawa Barat, Sumatera
19. 1.Tempat menyimpan air hujan.
2.Meningkatkan illegal loging masyarakat .
3. Mencegah terjadinya erosi .
4.Menghasilkan oksigen dan menyerap karbon dioksida .
5 Sumber kehidupan bagi masyarakat sekitar hutan
6 Menghasilkan karbon dioksida dan menyerap oksigen
Manakah dari pernyataan di atas yang merupakan manfaat atau fungsi hutan ?
1, 2, 3,  4
2, 4, 5,  6
1, 3, 4,  5
1, 4, 5,  6

20.  1.Hutan yang gundul bisa menjadi sebab terjadinya banjir pada musim hujan.
2.Kerusakan hutan dapat menjadikan peristiwa kekeringan dimusim kemarau.
3.Hilangnya potensi keuntungan negara dari pendapatan hasil hutan.
4.Tumbuhnya jenis baru flora dan fauna di hutan.
5.Menjadi sebab terjadinya fenomena perubahan iklim dan pemanasan global.
6.Membuat perbaikan ekosistem bagi yang ada didarat maupun dilaut.
Manakah dari pernyataan di atas yang merupakan dampak kerusakan hutan?
1, 2, 3, 4
1, 2, 3, 5
2, 3, 4, 6
1, 2, 3, 4
21. Contoh berikut merupakan bentuk dari interaksi keruangan pada berubahnya komposisi penduduk , yaitu ….
seseorang pergi berbelanja ke kota
Pak Amir bekerja di kota pagi hari pulang ke desa malam hari
banyak lahan perkebunan berubah menjadi permukiman
Semula sebagian besar etnik Betawi , kemudian berkembang menjadi beragam etnik
22. Peran penting dari wilayah selat Malaka  dalam perhubungan dunia adalah sebagai berikut :
jalur perhubungan negara-negara Asia Timur , seperti Jepang dan Kore Selatan untuk mengirimkan barang-barang ekspor ke Afrika dan Eropa.
jalur perhubungan negara-negara Eropa  untuk mengirimkan barang-barang ekspor ke Afrika dan Jerman-Inggris
jalur perhubungan negara-negara Asia Timur , seperti Jepang dan Kore Selatan untuk mengirimkan barang-barang ekspor ke Australia
jalur perhubungan negara-negara Asia Selatan untuk mengirimkan barang-barang ekspor ke Afrika dan Eropa.
23. Posisi Indonesia secara geologis , berada pada pertemuan tiga lempeng dengan memiliki banyak gunung api memberikan keuntungan bagi Indonesia , yakni….
Beragamnya flora dan fauna
Beragamnya potensi sumber energy dan mineral
Indonesia memiliki wilayah Garis Weber dan Wallacea
Sebagai jalur pelayaran dan perdagangan dunia
24. 1. Hutan berdaun lebar yang selalu hijau
2. curah hujan minimal 800 –  1200 mm/tahun
3. kelembaban rendah
4. curah hujan di atas 500 mm – di bawah 800 mm/tahun
5. suhu yang rendah sepanjang tahun
6. suhu yang tinggi sepanjang tahun
Manakah dari pernyataan di atas yang merupakan ciri dari hutan hujan tropis ?
25. Hutan sebagai perlindungan sistem penyangga kehidupan untuk mengatur tata air, mencegah banjir, mengendalikan erosi, mencegah intrusi laut, dan memelihara kesuburan tanah.Hal ini merupakan fungsi pokok hutan….

26.Daerah yang merupakan penghasil minyak bumi dari pulau Sumatra adalah….
Jati Barang Majalengka, sungai Gerong, Plaju, Babo
Sungai Pakning, Loukseumawe, sungai Gerong, Dumai
Delta, sungai Gerong, Amuntai, Jati Barang Majalengka
Klamono, Muara Enim, Pereula, Tarakan
27. Suatu lembaga terbentuk akibat dari berbagai aktivitas manusia dalam
memenuhi ….
Kepentingan pemerintah
Kebutuhan manusia
Keinginan partai-partai politik
Cita-cita bangsa Indonesia
28.Jika kalian perhatikan peta sebaran curah hujan di Indonesia, maka akan
ditemukan pola ….
a.umumnya curah hujan sangat besar di daerah pantai
b.semua wilayah di indonesia curah hujannya sangat tinggi
c.bagian utara setiap pulau curah hujannya rendah
d.umumnya, bagian barat pulau curah hujannya lebih tinggi dari bagian

Gambar rumah di atas merupakan bentuk rumah adat dari daerah ….
30.Hutan mangrove memiliki fungsi ekologis, yaitu ….
a.sebagai sumber kayu bakar
b.sebagai tempat wisata
c.sebagai tempat hidup berbagai makhluk hidup
d.sebagai tempat memancing ikan

31.Dilihat dari jenisnya, terumbu karang Indonesia merupakan salah satu yang terkaya di dunia. Secara ekonomis terumbu karang bermanfaat sebagai :
a.daerah tujuan wisata
b.tempat ikan berlindung
c.tempat ikan mencari makan
d.tempat berkembang biaknya ikan

32. 1 Kemiskinan dan pengangguran merajalela (ekonomi)
2.Kemacetan dan kepadatan yg sulit diatasi (sosial budaya)
3.Program pemerintah mendapat dukungan partai politik (politik)
4.Kriminalitas meningkat dan cepat terkendali  (sosial)
5.Pemukiman kumuh (sosial budaya)
6.Pendidikan memprioritaskan tempat-tempat yang terpencil (sosial)

Manakah dari pernyataan di atas yang merupakan dampak penyebaran penduduk yang tidak merata ?
1, 2, 4.
2, 3, 6
1, 2, 5
1, 3, 6
33.Bagaimanakah caranya pemerataan penduduk Indonesia di masa yang akan datang?
Pemerataan hasil pembangunan, memberikan pelatihan ketrampilan bagi pemuda  di daerah, urbanisasi
Pemerataan pembangunan, pemusatan industrialisasi di kota, ruralisasi
Pemerataan hasil pembangunan daerah , menciptakan tenaga ahli di bidang industri, transmigrasi
Pemerataan hasil pembangunan, menciptakan lapangan kerja di daerah, transmigrasi
34. Indonesia mengalami bonus demografi  , berkat keberhasilan dari program ….
Keluarga Berencana
35. Tingginya angka pengangguran, persebaran tidak merata, urbanisasi, menurunnya kualitas dan tingkat kesejahteraan. Hal ini disebabkan oleh….
Komposisi penduduk
Dinamika penduduk
Pertumbuhan penduduk
Kuantitas penduduk

36. Berdasarkan gambar pola angin di atas,  sebagian besar wilayah Indonesia akan mengalami….
musim penghujan
musim kemarau
musim pancaroba
musim panen tiba
37. Gambar binatang di atas adalah berasal dari daerah ….

Nusa Tenggara Timur
38.1. Sebagai pusat pemerintahan.
2. Sebagian besar tanahnya merupakan tanah vulkanis yang subur.
3 Merupakan pusat kegiatan ekonomi dan industri sehingga banyak tersedia   lapangan kerja.
4. Secara Historis merupakan pusat kerajaan-kerajan yang menguasai nusantara
5. merupakan daerah lumbung padi Asia Tenggara.
Manakah dari pernyataan di atas yang merupakan faktor-faktor penyebab tingginya tingkat migrasi ke pulau Jawa ?
1, 2, 3
1, 3, 4
2, 3, 4
1, 3, 5
39. Komposisi penduduk  berdasarkan jenis kelamin  (  sex ratio ) dapat di gunakan untuk memperkirakan bentuk pemberdayaan penduduk  sebagai sumber daya manusia sesuai dengan ….
Potensi diri
Bakat minat
Potensi alam
40.  Tolok ukur kualitas penduduk dapat dilihat dari ….
Pendidikan, gaya hidup masyarakat, Keluarga berencana
Kesehatan, mata pencaharian , pertumbuhan penduduk
Jumlah wiraswastawan, komposisi penduduk, jenjang pendidikan
Mata pencaharian, pendidikan , kesehatan
41. Manakah urutan nama rumah adat yang benar dari daerah : Sulawesi Utara, Papua, Kalimantan Tengah, Nanggroe Aceh Darussalam ?
Istana Buton, Honai, Betang, Krong Bade
Gadang, Honai, Banjar, Lamin
Honai, Betang, Istana Buton, Gadang
Istana Buton, Honai, Krong Bade, Banjar.
42.  Karakteristik Flora  yang ada di  Indonesia bagian barat  adalah sebagai berikut :
Jenis meranti-merantian sangat banyak, jenis tumbuhan matoa sedikit, terdapat berbagai rotan, terdapat hutan kayu putih, tumbuhan sagu sedikit.
Jenis meranti-merantian sangat banyak, jenis tumbuhan matoa sedikit, terdapat berbagai rotan, tidak terdapat hutan kayu putih, tumbuhan sagu sedikit.
Jenis meranti-merantian sangat banyak, jenis tumbuhan matoa sedikit, terdapat sedikit jenis rotan, terdapat hutan kayu putih, tumbuhan sagu sedikit.
Jenis meranti-merantian sangat sedikit, jenis tumbuhan matoa banyak, terdapat berbagai rotan, terdapat hutan kayu putih, tumbuhan sagu sedikit.
43. Manakah fauna di bawah ini yang terdapat di wilayah Indonesia bagian tengah ?
Cendrawasih, Walabi, harimau, badak bercula satu
Anoa, komodo, babi rusa, Ikan duyung
Nuri, tapir, bekantan, rusa
Walabi, banteng, gajah, orang utan

44.  Proses Interaksi social akan terjadi apabila diantara pihak yang berinteraksi  melakukan ….
Hubungan social dan memberi  informasi
Konflik social dan masalah social
Identifikasi  dan asimilasi
Kontak social dan komunikasi
45. Warga Belanda  yang sudah lama tinggal di Indonesia, akhirnya
bisa berbahasa Indonesia dengan sangat fasih. Namun dialek yang mereka
biasa pakai untuk berkomunikasi sudah tidak asli lagi karena sudah bercampur dengan bahasa Indonesia. Hal ini merupakan contoh proses socialyang disebut ….
46. Sistem norma atau aturan-aturan yang dapat kategorikan sebagai lembaga sosial harus memiliki syarat-syarat sebagai berikut :
Sebagian besar anggota masyarakat menerima norma,norma tersebut menjiwai seluruh warga dalam sistem sosial, norma tersebut mempunyai sanksi yang mengikat setiap anggota masyaraka
Sebagian besar anggota masyarakat menerima norma,norma tersebut mendorong seluruh warga dalam sistem sosial, norma tersebut mempunyai pepentingan yang mengikat setiap anggota masyaraka
Sebagian kecil anggota masyarakat menerima norma,norma tersebut melindungi seluruh warga dalam sistem sosial, norma tersebut mempunyai pepentingan yang mengikat setiap anggota masyaraka
Sebagian besar anggota masyarakat menerima norma,norma tersebut menilai  seluruh warga dalam sistem sosial, norma tersebut mempunyai tujuan  yang mengikat setiap anggota masyaraka
47.Si Fulan sudah dua kali tidak melakukan piket di kelasnya.Tindakan si Fulan tersebut melanggar norma ….
48. Lembaga sosial yang mengatur hubungan antar manusia dalam pemenuhan kebutuhan hidup disebut lembaga ….
49. Salah satu fungsi laten ( fungsi yang tidak disadari ) dari lembaga pendidikan yaitu :
Menanamkan ketrampilan yang perlu bagi partisipasi dalam demokrasi
Melestarikan kebudayaan masyarakat
Mengembangkan bakat perseorangan
Mengurangi pengendalian orang tua
50. Keluarga memberikan kasih sayang dan perhatian pada anak-anaknya. Dalam keluarga pula diharapkan akan memberikan kehangatan perasaan pada anggota keluarganya seperti seorang bapak yang tetap memberikan perhatian dan kasih sayang kepada anak-anaknya tanpa membeda-bedakan. Pernyataan ini merupakansalah satu fungsi keluarga yaitu….
Pemberian status


LATIHAN UKK Mata Pelajaran IPS Tema 4 Kelas VIII
1. Syarat utama dalam melakukan interaksi sosial ialah ….
2. Interaksi sosial yang mengarah kepada persatuan ialah ….
3. Pertandingan bola Persib melawan Persipura merupakan jenis interaksi sosial …
4. Perebutan pulau Simpadan dan Ligitan oleh Malaysia diselesaikan melalui Mahkamah Internasional merupakan bentuk interaksi sosial ….
5. Budaya kerjasama yang masih dipertahankan di lingkungan pedesaan ialah ….
6. Akulturasi yang tampak pada bangunan masjid Demak ialah ….
7. Tari Saman merupakan bentuk asimilasi yang memiliki pesan nilai ….
8. Kicauan di media sosial antara Ahmad Dani sebagai pentolan dari grup band terkenal dengan Farhat Abbas sebagai pengacara merupakan bentuk interaksi sosial ….
9. Suku bangsa di Indonesia yang paling banyak populasinya ialah ….
10. Bahasa Indonesia dalam UUD 1945 terletak pada pasal ….
11. Fungsi utama bahasa Indonesia yaitu ….
12. Penggunaan bahasa daerah dalam upacara adat daerah menunjukkan peran bahasa sebagai ….
13. Peranan Bank dalam pengelolaan Trans Studio sebagai tempat pariwisata ialah ….
14. Keragaman sosial dan budaya bangsa Indonesia tampak dalam aspek ….
15. Pengelolaan keragaman budaya di lingkungan pendidikan ialah ….

A. Puncak dari atap berundak – undak menyerupai atap candi Hindu namun fungsinya sebagai tempat ibadah umat Islam
B. Sebagai tempat transaksi tiket dan pembelian kupon makan maupun souvenir
C. pesan pendidikan keagamaan, sopan santun, kepahlawanan, kekompakan dan kebersamaan.
D. Alat komunikasi, alat ekspresi diri, dan alat kontrol sosial.
E. Adanya bahasa daerah sebagai kurikulum muatan lokal
F. Mengandung nilai tinggi budaya
G. Kelompok dengan kelompok
H. Komunikasi dan kontak sosial
I. UUD 1945 pasal 36
J. Gotong Royong
K. Kontravensi
L. Akomodasi
M. Pariwisata
N. Suku Jawa
O. Asosiatif


1.    Suatu organisasi Ekonomi yang bertujuan mengurangi tarip barang-barang tertentu disebut
a.    IFC            c. ITO
b.    UNEDA        d. GATT
2.    Kebijakan ekonomi internasional suatu negara yang ingin menghindarkan diri dari berbagai pengaruh dari negara lain disebut ………………
a.    Autarki            c. regulasi
b.    Proteksi        d. monopoli
3.    Penanaman modal asing mendukung kesejahteraan masyarakat karena ………………
a.    Pajak perusahaan asing di dalam negara tidak meningkat
b.    Membuka peluang tersedianya lapangan kerja
c.    Meningkatkan nilai impor
d.    Kegiatan ekonomi dalam negeri tidak mengalami perubahan
4.    Organisasi Internasional di bawah ini yang tidak bernaung di bawah PBB adalah ………………..
a.    CGI            c. UNDP
b.    WTO            d. IMF
5.    UNINDO adalah organisasi yang bergerak di bidang …………………………………………
a. pertanian    c. perindustrian
b. perdagangan    d. pembangunan
6.    Negara-negara berikut merupakan pendiri OPEC adalah …………….. ……………. …………. …
a.  Saudi Arabia, Venezuela
b.  Amerika Serikat, Inggris
c.  Yugoslavia, Mesir
d.  Yordania, Mesir
7.    ITO adalah kerja sama antar negara di dunia dalam bidang ……………….. ………. ………..
a. pertahanan    c. perekonomian
b. perikanan    d. perdagangan
8.    Kebijakan Impor yang ditetapkan oleh suatu negara yang bertujuan untuk melindungi produksi dalam negeri adalah ……. …….. …….. ……….
a. moneter    c. fiskal
b. proteksi    d. dumping
9.    Usaha peningkatan ekspor dengan cara memperbanyak ragam barang yang diekspor disebut …. …. ….. …………. …….. …………..
a. deversifikasi horisontal    c. revaluasi
b. deversifikasi vertikal    d. devaluasi
10.    Apabila nilai ekspor lebih besar dibanding dengan impor, hal itu disebut …. ……. ……… ……. …
a. defisir    c. seimbang
b. surplus    d. minus
11.    Pidato Presiden Soekarno pada tanggal 17 Agustus 1959 berjudul …………………… ……
a. Jangan Melupakan Sejarah
b. Hilangnya Keraguan Terhadap Revolusi Kita
c.    Jalannya Revolusi Bagaikan Malaikat Turun Dari Langit
12.    Sila Pancasila yang berkaitan erat dengan Demokrasi terpimpin adalah sila ke ….. ….. …. ..
a. 1    c. 3
b. 2    d. 4
13.    Perhatikan pernyatan di bawah ini
1).  Setuju kembali ke UUD 1945
2).  Setuju kepada perjuangan RI
3).  Setuju dengan Manifesto Politik
4).    Setuju Soekarno sebagai Panglima Besar Revolusi
5).    Setuju Soekarno sebagai Presiden seumur hidup
Persyaratan sebagai calon anggota MPRS yang ditunjuk dan diangkat oleh Presiden Soekarno harus menyetujui 3 syarat, yaitu ……….
a. 1, 2, 3     c. 2, 3, 5
b. 2, 3, 4    d. 3, 4, 5
14.    Yang dimaksud Front Nasional adalah ………..
a.     Organisasi massa yang memperjuangkan cita-cita proklamsi dan cita-cita yang terkandung dalam UUD 1945
b.    Lembaga militer yang menyiapkan kader-kadernya untuk bertempur di garis depan
c.    Lembaga militer yang dimiliki oleh tiap-tiap propinsi dan berjuang demi kepentingan nasional
d.    Organisasi yang anggotanya dari berbagai kalangan masayarakat yang berjuang secara nasional
15.    Bangsa Indonesia pada masa demokrasi terpimpin pernah melaksanakan politik “mercusuar”. Artinnya …… …….. …….. ……
a.     Selalu berusaha untuk memperjuangkan negara-negara lain
b.    Selalu mengejar kemegahan dalam pergaulan internasional
c.    Selalu berusaha sebagai dewa penolong negara-negara lain
d.    Selalu berusaha membangun kepentingan dalam negeri melebihi kepentingan luar negeri
16.    PKI telah memfitnah ABRI tentang adanay kelompok para Jendraln yang ingin merebut kekuasaan negara, yang dinamakan …… …….
a. Angkatan ke-5
b. BarisanPendukung Soekarno
c. Dewan Jendral
d. Dewan Revolusi
17.    Yang menjdi korban pembantaian G30S/PKI di Yogyakarta adalah …… …… …… …… ….. …
a. letnan P. A Tendean dan kol Suherman
b. kol. Katamso dan Lekol Sugiono
c. Brigjen Pol Satsuitubun dan mayor Mulyono
d. kapten Soeharno dan mayor Sumadi
18.    Setiap tanggal 1 Oktober diperingati sebagai hari
a. kebangkitan Orde Baru    c. Kesaktian Pancasila
b. Lahirnya Pancasila    d. Ulang Tahun ABRI
19.    Pelaksanaan Pancasila secar murni dan konsekwen merupakan arti dari ………. ….. ….
a. demokrasi Pancasila    c. Orde Lama
b. demokrasi terpimpin    d. Orde Baru
20.    Penyelewengan Politik pada masa Orde Lama adalah ……. ………….. …….. …….. …… ….
a. pembebasan Iian Barat
b. pembelianm senjata dari AS
c. konfrontasi dengan Malaysia
d. ikut KTT non blok
21.    Dalam rangka merintis kembali normalisasi hubungan dengan Malaysia maka sebelumnya dimulai dengan perundingan …… …… ….. ……
a. Jakarta Accord    c. Kualalumpur
b. Bangkok    d. Panca Negara
22.    Para perwira tinggi yang gugur dalam peristiwa G30 S/PKI dianugerahi Pahlawan ……… …….
a. Ampera    c. Revolusi
b. Seroja    d. tanpa tanda jasa
23.    Indoesia kembali masuk menjadi anggota PBB dengan pertimbangan ….. …… ….. ….. …. …..
a.    Indonesia membutuhkan PBB untukj menyelesaian masalah Timor Timur
b.    masih berlangsungnya perang dingin anara blok Barat dan blok Timur
c.    adanya tekanan dari negara non blok
d.    Indonesia banyak mendapat manfaat selama menjadi anggota PBB
24.    Pernyataan bersama 5 Menteri Luar Negeri untuk membentuk ASEAN, tercantum dalam …. …. …
a. Deklarasi Bangkok    c.Dokumen Manila
b. Deklarasi Brunai    d.ASEAN Meeting
25.    Salah satu dasar pembentukan ASEAN adalah negara-negara Asia Tenggara … …. …. … … …
a. ingin menjadi negara merdeka
b. memiliki kekayaan alam yang melimpah
c. menjadi pereda ketegangan dunia
d. termasuk negara-negara berkembang

26.    Luas permukaan bumi seluruhnya adalah 512.000.000 km2, terdiri dari ……… ….. …. ….
a. daratan 70% dan lautan 30%
b. daratan 30% dan lautan 70%
c. daratan 40% dan lautan 60%
d. daratan 60% dan lautan 40%
27.    Negara yang berada di Eropa Timur adalah … …
a. Estonia    c. Monaco
b. Rumania    d. Andora
28.    Sungai terpanjang di Amerika Utara adalah … …
a. Amazon    c. Missisipi
b. Missouri    d. Tenesse
29.    Penduduk asli Benua Amerika adalah … … … ..
a. Eskimo dasn Indian    c. Mestis dan Negro
b. Rambo dan Aborigin    d. Indian dan Negro
30.    Orang-orang Asia yang hidup diAustralia ada sekitar …. …. …….. …. …….. ….. …… ……..
a. 94,4%    c. 1,1 %
b. 2,1   %    d. 2,4 %
31.    Daerah kutub selatan disebut juga ….. …. …. ….
a. Antartika    c. Atlantik
b. Arktik    d. Pasific
32.    Negara Swiss banyak didiami suku bangsa …. ..
a. Nordik    c. Alpen
b. Dinarik    d. Mediterania
33.    Samodra yang paling sempit adalah .. …… ……
a. Pacific    c. Hindia
b. Atlantik    d. Arktik
34.    Arus dingin Oyasiwo terdapat di samodra … ……
a. Pacific    c. Hindia
b. Atlantik    d. Arktik
35.    Batas Negara Mesir sebelah selatan adalah …. ….
a. Libya    c. laut tengah
b. Sudan    d. laut merah
36.    Ibu kota negar Mesir adalah … ….. …….
a. Riyadh    c. Baghdad
b. Kairo    d. Wina
37.    Salah satu seni, merangkai bunga di Jepang disebut … …… ………….. ………. …… …….
a. Arigato    c. bonsai
b. ikebana    d. sumo
38.    Sebagian besar penduduk Jepang beragama ….
a. Khong Hu Cu    c. Shinto
b. Budha    d. Kristen
39.    Wilayah China bagian utara berbatasan dengan …
a. Asia Tenggara    c. Pakistan dan India
b. Korea dan Jepang    d. Rep. Mongol dan Rusia
40.    Negara yang dijuluki raja Kopi dunia adalah ….
a. Brasil    c. Mesir
b. Indonesia    d. India

Soal Semester Genap SMP Mapel IPS

1.    Panglima tentara tertinggi jepang untuk kawasan Asia Tenggara berkedudukan di ….
a.    Dalath        c. Jakarta
b.    Tarakan        d. Bukittinggi
2.    Berikut merupakan orang jepang yang menjadi anggota BPUPKI adalah ….
a.    Kuniaki Kuiso    c. Ichibangase
b.    Tadashi Maeda    d. Hideki Tojo
3.    Siding pertama BPUPKI berlangsung ….
a.    28 Mei-1 Juni 1945
b.    28 Mei-2 Juni 1945
c.    29 Mei-1 Juni 1945
d.    29 Mei-7 Juni 1945
4.    Anggota PPKI secara keseluruhan berjumlah …. orang
a.    25            c. 27
b.    26            d. 29
5.    Ir. Soekarno pada masa persiapan kemerdekaan pernah menjabat sebagai ketua ….
a.    Peta        c. PPKI
b.    KNIP        d. BPUPKI
6.    Rancangan rumusan undang-undang dasar disusun oleh ….
a.    Pemerintah jepang        c. BPUPKI
b.    Volksraad            d. PPKI
7.    Tokoh-tokoh berikut yang memberikan pendapatnya mengenai dasar-dasar Negara Indonesia, kecuali ….
a.    Soeomo        c. Ir. Soekarno
b.    Moh. Hatta    d. Muh. Yamin
8.    Tokoh yang mendapatkan tugas mengetik naskah proklamasi adalah ….
a.    Sukarni        c. Sajoeti Malik
b.    Moh. Hatta    d. Ir. Soekarno
9.    Tugas untuk membawa ir. Soekarno-Moh. Hatta ke Rengasdengklok dipercayakan pada ….
a.    Singgih    c. Chairul Saleh
b.    Subeno    d. Sutan Syahrir

10.    Siding PPKI yang pertama tanggal ….
a.    17 Agustus 1945
b.    18 Agustus 1945
c.    19 Agustus 1945
d.    20 Agustus 1945
11.    Berikut yang merupakan bentuk kerja sama adalah ….
a.    Koersi        c. Bargaining
b.    Kompromi        d. Kontravensi
12.    Berikut merupakan factor pendorong hubungan social yang merupakan hasrat menjadikan dirinya seperti orang lain disebut dengan ….
a.    Empati        c. Identifikasi
b.    Imitasi        d. Sugesti
13.    Hubungan social yang mampu mewujudkan hidup rukun, damai, dan harmonis adalah hubungan social dengan jenis ….
a.    Asosiatif        c. Disosiatif
b.    Asimetris        d. Antarstatus
14.    Adjudication merupakan akomodasi dimana dalam menyelesaikan pertentangan atau pertikaian dilakukan di ….
a.    Pengadilan adat    c. Kepolisian
b.    Pengadilan        d. Kejaksaan
15.    Sebagai pedoman dan tingkah laku dalam masyarakat merupakan … pranata social
a.    Fungsi        c. Tujuan
b.    Cirri-ciri        d. Latar belakang
16.    Sebagai pranata social pasti mempunyai cirri sebagai berikut, kecuali ….
a.    Symbol sendiri    c. Alat kelengkapan
b.    Umur lebih lama    d. Sanksi
17.    Lembaga yang bertugas membuat perundang-undangan adalah ….
A.    Yudikatif        c. Legislative
B.    Eksekutif        d. Yudikatif
18.    Waktu dan tempat belajar disesuaikan dengan situasi merupakan salah satu cirri pendidikan ….
a.    Formal        c. Informal
b.    Formalitas        d. Nonformal
19.    Berikut merupakan pranata yang bertujuan untuk memenuhi kebutuhan social dan kekerabatan adalah pranata ….
a.    Industry        c. Pemerintahan
b.    Perkawinan    d. Tempat kursus
20.    Sosialisasi pertama yang dijalani individu semasa kecil dinamakan ….
a.    Internalisasi    c. Sosialisasi sekunder
b.    Sosialisasi pimer    d. Sosilisasi tambahan
21.    Membentuk warga Negara yang cinta tanah air merupakan fungsi pranata ….
a.    Politik        c. Ekonomi
b.    Agama        d. Pendidikan
22.    Pengendalian social dengan kekerasan dapat diterapkan kepada orag yang melakukan perbuatan ….
a.    Kurang komunikatif    c. Kurang sopan
b.    Tidak ramah        d. Kejahatan
23.    Pada siswa yang sering membolos diterapkan pengendalian social berupa ….
a.    Ejekan        c. Hukuman
b.    Teguran        d. Cemoohan
24.    Pengendalian social dengan gosip dilakukan secara ….
a.    Negative        c. Terbuka
b.    Positif        d. Tertutup
25.    Seorang tokoh masyarakat dapat berperan menjadi lembaga pengendalian social karena mempunyai ….
a.    Kekayaan        c. Keturunan
b.    Pengaruh        d. Kekebalan
26.    Meminta bantuan kepada orang lain untuk mengatasi maslah disebut dengan ….
a.    Intimidasi        c. Faraundulens
b.    Ostrasisme        d. Desas-desus
27.    Pengendalian social yang dilakukan dengan kekerasan atau paksaan merupakan pengendalian social secara ….
a.    Preventif        c. Represif
b.    Persuasive        d. Kuratif
28.    Hubungan social yang positif memiliki sifat ….
a.    Memisahkan    c. Menghancurkan
b.    Mempersatukan    d. Menceraiberaikan
29.    Upaya untuk menyelesaikan suatu konflik dinamkan ….
a.    Kooperasi        c. Akomodasi
b.    Kompetisi        d. Kontravensi
30.    Aktivitas social yang berkaitan dengan proses pengadaan barang merupakan bagian dari pranata ….
a.    Pendidikan        c. Keluarga
b.    Ekonomi        d. Politik
31.    Program untuk mengatasi persebaran tenaga kerja yang tidak merata adalah ….
a.    Urbanisasi        c. KB
b.    BLK        d. Transmigrasi
32.    Batasan usia kerja di Indonesia adalah ….
a.    10 tahun s.d. 65 tahun
b.    15 tahun s.d. 64 tahun
c.    17 tahun s.d. 70 tahun
d.    14 tahun s.d. 60 tahun
33.    Golongan produktif biasa disebut dengan ….
a.    Tenaga kerja    c. Angkatan kerja
b.    Pekerja        d. Pengangguran
34.    System ekonomi komando juga sering disebut dengan system ekonomi ….
a.    Kapitalis        c. Sosialis
b.    Imperialis        d. Marxis
35.    System ekonomi liberal bnayak digunakan oleh Negara ….
a.    Sosialis        c. Maju
b.    Berkembang    d. Asia
36.    Badan usaha yang dinilai paling cocok dengan UUD 1945 adalah ….
a.    BUMN        c. Swasta
b.    BUMD        d. Koperasi
37.    Pendirian BUMN sesuai dengan UUD 1945 pasal ….
a.    31            c. 33
b.    32            d. 34
38.    Pungutan resmi dari pemerintah kepada produsen tertentu atas barang-barang yang diproduksi adalah ….
a.    Pajak        c. Cukai
b.    Retribusi        d. Subsidi
39.    Kebijakan pemerintah dengan menggunakan pajak sebagai alat untuk mengendalikan perekonomian disebut dengan kebijakan ….
a.    Fiscal        c. Pasar terbuka
b.    Moneter        d. Regular
40.    Pajak yang dipungut oleh pemerintah daerah tingkat I disebut pajak ….
a.    Negara        c. Kabupaten
b.    Provinsi        d. Langsung
41.    Tariff pajak yang berlaku tetap untuk setiap nilai objek pajak adalah 10%, dalam halm ini tariff pajak yang berlaku adalah ….
a.    Tetap        c. Progresif
b.    Proporsional    d. Regresif
42.    Berikut ini objek pajak yang tidak dikenai PBBadalah ….
a.    Jalan tol        c. Dermaga
b.    Kolam renang    d. Panti asuhan
43.    Pihak yang melakukan kegiatan permintaan adalah ….
a.    Penjual        c. Distributor
b.    Pembeli        d. Agen
44.    Berikut yang termasuk angkatan kerja potensial adalah ….
a.    Guru        c. Mahasiswa
b.    Tukang kebun    d. Pekerja kantin
45.    UU No. 17 Tahun 2012 mengatur tentang ….
a.    BUMN        c. BUMS
b.    BUMD        d. Koperasi
46.    Tokoh yang mengemukakan bahwa pelaku ekonomi harus diberi kebebasan adalah ….
a.    Adam Smith    c. Karl Marx
b.    Soekarno        d. Paul
47.    Pungutan resmi dari pemerintah kepada pihak yang menjual produk ke luar negeri adalah ….
a.    Cukai        c. Bea impor
b.    Bea materai    d. Bea ekspor
48.    Dalam hokum permintaan, factor yang memengaruhi permintaan adalah ….
a.    Jumlah        c. Pendapatan
b.    Harga        d. Teknologi
49.    Permintaan gelandangan terhadap mobil, termasuk dalam permintaan …..
a.    Efektif        c. Absolute
b.    Potensial        d. Mutlak
50.    Proses tawar-menawar yang terus menerus akhirnya membentuk ….
a.    Harga pokok    c. Harga sahabat
b.    Harga pasar    d. Harga diskon

Pembahasan Soal IPS SMP Kelas 8 Semester genap

1.    Pembentukan BPUPKI dan PPKI sebagai upaya persiapan kemerdekaan Indonesia dilator belakangi oleh……
a. Janji Perdana menteri Kaiso guna meraih simpati dan dukungan untuk memenangkan perang
b. Keputusan Jepang dalam upaya memenangkan peperangan dikawasan Asia dan Pasifik
c. Usulan para pemimpin bangsa Indonesia kepada kepala pemerintah militer Jepang
d. Perkembangan terakhir peperangan antara Jepang melawan Sekutu di Pasifik
2.    Perhatikan nama-nama berikut!
1) Ir. Soekarno            3) A.A. Maramis            5) H. Agus Salim
2) Abdul Latif            4) Mr. Muh. Yamin        6) Prof. Dr. Soepomo
Tokoh-tokoh yang termasuk dalam panitia Sembilan adalah…..
a. 1), 2), 3) dan 4)        b. 1), 2), 5) dan 6)    c. 1), 3), 4) dan 5)    d. 2), 3), 4) dan 5)
3.    Salah satu agenda dalam siding PPKI tanggal 18 AGustus 1945 adalah…..
a. Penetapan bentuk negar    a            c. Penyusunan anggaran dasar
b. Pembentukan MPRS                c. Pemilihan Presiden dan wakil presiden
4.    Para pemuda menemui Bung Karno dan Bung Hatta. Setelah mendengar bahwa Jepang menyerah kepada sekutu pada tanggal 15 Agustus 1945. Pada saat itu, tanggapan Bung Karno adalah…..
a. Segera memutuskan untuk memproklamasikan kemerdekaan
b. Segera mempersiapkan naskah proklamasi
c. Menghubungi laksamana Maida untuk berdiskusi
d. Tetap berpendapat bahwa Jepang masih berkuasa secara De Facto
5.    Proklamasi Kemerdekaan Indonesia yang dilaksanakan pada tanggal 17 Agustus 1945 adalah saat yang tepat mengingat Indonesia dalam keadaan Vacuum Of Power adalah…..
a. Kekosongan kekuasaan                c. Kekalahan Jepang
b. Kekurangan tentara                d. Kekuatan yang memuncak
6.    Mengapa terjadi pertempuran di berbagai daerah pada awal kemerdekaan…..
a. Bangsa Indonesia suka berperang        c. Penjajah ingin mempertahankan kekuasaannya
b. Tidak ada rasa persatuan di kalangan rakyat    d. Proklamasi tidak didukung oleh seluruh rakyat
7.    Sebab khusus pertempuran Surabaya adalah…..
a. Terbunuhnya jenderal Malaby            c. Kedatangan pasukan AFNEI(Sekutu)
b. Kedatangan pasukan Manseroh            d. Adanya semangat memperjuangkan kemerdekaan
8.    Latar belakang terjadinya pertempuran di Yogyakarta adalah…..
a. Jepang menggempur lapangan udara Maguwo
b. Belanda melakukan agresi militer ke Yogyakarta
c. Pemuda Yogyakarta mengambil alih pabrik-pabrik gula
d. Jepang bersikeras mempertahankan kekuasaannya di Indonesia
9.    Pada awal terbentuknya RI, lembaga yang melaksanakan tugas MPR adalah…..
a. KNIP            b. BKR            c. PPKI            d. BPUPKI
10.    Pengesahan dan penetapan UUD 1945 serta pemilihan Presiden dan Wakil Presiden merupakan keputusan dalam siding…..
a. PPKI tanggal 18 Agustus 1945            c. PPKI tanggal 22 Agustus 1945
b. PPKI tanggal 19 AGustus 1945            d. BPUPKI tanggal 18 Agustus 1945
11.    Manusia adalah Zoon Politicon. Pernyataan tersebut pertama diungkapkan oleh…..
a. Aristoteles        b. Decartes        c. Emile Durkheim    d. Selo Soemardjan
12.    Hasrat berproduksi mendorong seseorang melakukan hubungan sosial karena…..
a. Mampu meneruskan keturunan dari generasi ke generasi berikutnya
b. Hanya dengan berhubungan sosial seseorang mengenal lawan jenisnya yang akan
mengantarkannya ke perkawinan
c. Ingin dicintai oleh lawan jenisnya
d. Dengan hubungan sosial seseorang mendapatkan sahabat
13.    Berikut ini yang termasuk hubungan sosial antar kelompok adalah…..
a. Seorang polisi menilang seorang pengendara sepeda motor
b. Rapat antara pihak sekolah dengan wali murid guan menentukan besar uang gedung
c. Kepala sekolah memimpin rapat guru
d. Massa mengeroyok seorang pencuri
14.    Akomodasi merupakan hubungan sosial yang bersifat positif karena…..
a. Mengumpulkan banyak pihak
b. Menyelesaikan pertentangan tanpa menghancurkan pihak lawan
c. Mengajak anggota masyarakat untuk berempati dan bertoleransi
d. Memicu munculnya konflik antar kelompok
15.    Berikut ini yang termasuk hubungan sosial disosiatif adalah…..
a. Aksi demo menolak harga BBM berakhir dengan kerusuhan
b. Perkawinan campuran antar warga asing
c. Kerja bakti menyambut hari kemerdekaan Indonesia
d. Gotong royong menanam padi disawah
16.    Hadirnya pihak keluarga sebagai penasihat dalam perselisihan merupakan karakteristik dari…..
a. Abitration            b. Coersion        c. Mediator        d. Conciliation
17.    Manakah yang merupakan pengertian pranata sosial menurut Koenjaraningrat…..
a. Sistem norma untuk mencapai tujuan yang dianggap penting
b. Sistem peraturan dan adat istiadat yang mempertahankan nilai-nilai penting
c. Tata cara kehidupan kelompok yang apabila dilanggar dijatuhi berbagai sanksi
d. Tata kelakuan yang berpusat pada aktivitas-aktivitas untuk memenuhi kebutuhan
18.    Salah satu faktor yang menyebabkan pranata sulit mengalami perubahan adalah…..
a. Internalisasi dan pengendalian sosial        c. Instituonalisasi dan tipifikasi
b. Interaksi dan sosialisasi                d. Habitualisasi dan tipifikasi
19.    Berikut ini yang merupakan urutan tahapan terbentuknya pranata sosial dalam masyarakat adalah…..
a. Tipifikasi, habitualisasi dan internalisasi        c. Internalisasi, habitualisasi dan tipifikasi
b. Habitualisasi, tipifikasi dan internalisasi        d. Internalisasi, tipifikasi dan habitualisasi
20.    Perhatikan tipe-tipe pranata sosial berikut :
1) General Institutions        3) Enacted Institutionas            5) Restricted
2) Basic Institutions            4) Cresive Institutions
Manakah yang termasuk tipe pranata sosial jika dilihat dari sudut penyebarannya?
a. 1) dan 2)            b. 1) dan 3)        c. 1) dan 4)        d. 1) dan 5)
21.    Fungsi pranata keluarga yang berkaitan dengan kelangsungan hidup generasi adalah fungsi…..
a. Afeksi            b. Sosialisasi        c. Reproduksi        d. Religius
22.    Andika mendapat peringatan keras dari kepala sekolah karena sering membolos pada jam pelajaran Matematika. Apabila dilihat dari cakupannya pengendalian sosial diatas berupa pengawasan…..
a. Antar Individu                    c. Individu terhadap kelompok
b. Antar kelompok                    d. Kelompok antar individu

23.    Perhatikan pernyataan-pernyataan berikut!
1) Kepala sekolah mengimbau kepada murid-muridnya rajin belajar guna menghadapi ujian akhir
2) Rudi mendapat surat peringatan langsung dari guru BP karena ketahuan merokok disekolah
3) Seorang pencopet dikeroyok massa
4) Bapak dan Ibu Linda menasehati terus menerus untuk menjadi anak yang sopan
Manakah yang termasuk pengendalian sosial bersifat represif…..
a. 1) dan 4)            b. 2) dan 3)        c. 3) dan 4)        d. 4) dan 5)
24.    Cara pengendalian sosial yang dikemukakan pertama kali oleh Lapiere adalah…..
a. Sosialisasi        b. Compulsion        c. Koersif        d. Tekanan sosial
25.    Manakah dari contoh berikut yang termasuk pengendalian sosial secara koersif?
a. Mensosialisasikan sikap sopan kepada anak-anak        c. Iklan penghematan energi
b. Hukum mati seorang teroris                d. Ditetapkannya daerah bebas merokok
26.    Salah satu jenis pengendalian sosial pada masyarakat modern yang merupakan produk badan eksekutif adalah…..
a. Denda ulang        b. Pencekalan        c. Somasi        d. Ganti rugi
27.    Pihak yang paling menentukan kegiatan produktif suatu perekonomian adalah…..
a. Angkatan kerja        b. Kesempatan kerja    c. Usia kerja        d. Tenaga kerja
28.    Permintaan tenaga kerja sering juga disebut…..
a. Angkatan kerja        b. Kesempatan kerja    c. Usia kerja        d. Pengangguran
29.    Awalnya Nina bekerja di pabrik garmen, oleh karena krisis ekonomi berkepanjangan, pabrik garmen tempat Nina bekerja terpaksa melakukan PHK. Nina termasuk salah satu karyawan yang kena PHK dan akhirnya menganggur. Nina termasuk pengangguran…..
a. Musiman            b. Friksional        c. Struktural        d. Siklikal
30.    Pengangguran struktural terjadi karena…..
a. Resesi ekonomi yang sering terjadi        c. Perubahan permintaan tenaga kerja secara berkala
b. Pertumbuhan ekonomi yang cepat         d. Perubahan kondisi dan politik
31.    Sektor usaha saat ini membutuhkan tenaga kerja yang siap pakai. Upaya pemerintah mengatasi hal tersebut dilakukan dengan cara…..
a. Menambah jumlah guru                c. Membangun gedung-gedung sekolah
b. Melaksanakan program pendidikan dasar        d. Memperbaiki kurikulum lebih apikatif
32.    Perhatikan kegiatan-kegiatan yang dilakukan pemerintah berikut ini!
1) Pendidikan formal        3) Program padat karya        5) Mengurangi jumlah penduduk
2) Perbaikan gizi masyarakat    4) Pembinaan wirausaha
Cara pemerintah untuk memperbaiki mutu tenaga kerja ditunjukkan nomor…..
a. 1) dan 2)            b. 2) dan 3)        c. 3) dan 4)        d. 4) dan 5)
33.    Munculnya system ekonomi campuran disebabkan oleh…..
a. Adanya kebebasan dalam bersaing dan berusaha
b. Adanya kelemahan system ekonomi sosialis dan system liberal
c. Semakin banyaknya campur tangan pemerintah dalam perekonomian
d. Semakin banyaknya negara yang menerapkan system liberal
34.    Kelemahan system ekonomi terpusat yaitu…..
a. Persaingan yang tidak sehat untuk mencapai kemakmuran
b. Monopoli sumber daya ekonomi oleh pemilik modal
c. Tidak ada kebebasan individu untuk berinisiatif
d. Mudah terjadi gejolak ekonomi
35.    Pada system ekonomi liberal, masyarakat akan terbagi menjadi dua golongan yaitu…..
a. Pemodal dan pemerintah                c. Pemodal dan buruh
b. Pemerintah dan buruh                d. Tradisional dan modern
36.    Dasar pelaksanaan system ekonomi Indonesia adalah UUD 1945 pasal…..
a. 32            b. 33            c. 34            d. 31
37.    Salah satu ciri negative yang harus dihindari oleh system perekonomian Indonesia adalah…..
a. Potensi setiap masyarakat harus disalurkan kepada pemerintah
b. Tidak adanya perusahaan swasta dalam perekonomian
c. Kebebasan individu yang merugikan orang lain
d. Setiap warga negara mentaati peraturan pemerintah
38.    Salah satu kelemahan system ekonomi di Indonesia adalah…..
a. Sangat besarnya peran pemerintah sehingga tidak ada inisiatif masyarakat
b. Terjadinya monopoli sumber ekonomi
c. Adanya perusahaan-perusahaan untuk negara
d. Adanya unit ekonomi kerakyatan yang berdasarkan azas kekeluargaan
39.    Tarif yang pemungutannya berdasarkan nilai objek pajak merupakan ketentuan tariff pajak…..
a. Tetap            b. Degresif        c. Progresif        d. Proporsional
40.    Ketika melewati jalan tol, kebdaraan jalan tol harus membayar tiket. Sejumlah uang yang dikeluarkan pengguna jalan tersebut termasuk pembayaran…..
a. Pajak            b. Iuran            c. Retribusi        d. Sumbangan
41.    Pajak penghasilan (PPh) diatur dalam…..
a. Undang-undang Nomor 17 Tahun 2000        c. Undang-undang Nomor 12 Tahun 1985
b. Undang-undang Nomor 18 Tahun 2000        d. Undang-undang Nomor 12 Tahun 1994
42.    Gaji Pak Aris setiap bulannya sebesar Rp. 3.000.000,-. Iuran pensiun yang harus dibayar Rp. 100.000,-. Dan iuran jaminan kesehatan kerja Rp. 50.000,-. Pak Aris sudah berkeluarga dan memiliki satu orang anak.
Besarnya pajak penghasilan yang harus dibayar pak Aris adalah…..
a. Rp. 30.000,-        b. Rp. 34.500,-        c. Rp 77.500,-        d. Rp. 12.500,-
43.    Pak Andi mempunyai objek pajak di Surabaya dan Jakarta. Di Surabaya abjek pajaknya sebesar Rp. 80.000.000,-. Di Jakarta objek pajaknya sebesar Rp. 115.000.000,-. Besar pajak terutang Pak Andi adalah…..
a. Rp. 180.000,-        b. Rp. 181.000,-        c. Rp. 182.000,-        d. Rp. 183.000,-
44.    Berikut ini beberapa macam pajak!
1) Pajak reklame        3) Pajak hotel            5) Bea Materai
2) Pajak ekspor        4) Pajak kendaraan bermotor
Dari keterangan diatas, yang termasuk pajak daerah adalah…..
a. 1), 2) dan 3)        b. 1), 3) dan 4)        c. 1), 3) dan 5)        d. 2), 3) dan 4)
45.    Permintaan suatu barang di pasar akan bertambah jika…..
a. Selera masyarakat tidak berubah            c. Harga barng subtitusi menurun
b. Produksi barang beraneka ragam            d. Harga barang subtitusi naik
46.    Perhatikan faktor-faktor yang mempengaruhi permintaan berikut!
1) Penghasilan masyarakat bertambah        4) Selera masyarakat tidak berubah
2) Harga barang turun                5) Harga dimungkinkan naik pada masa depan
3) Harga barang pengganti turun
Faktor-faktor diatas yang menaikkan permintaan adalah…..
a. 1), 2) dan 3)        b. 1), 3) dan 5)        c. 1), 2) dan 5        d. 3), 4) dan 5)
47.    Kurva penawaran memiliki kemiringan positif, artinya…..
a. Ketika harga naik, produsen menambah jumlah barang yang ditawarkan
b. Ketika harga turun, produsen menambah jumlah barang yang ditawarkan
c. Ketika harga naik, produsen mengurangi jumlah barang yang ditawarkan
d. Ketika harga turun, produsen menghentikan kegiatan produksi atas suatu barang
48.    Perhatikan table berikut ini!
Harga 1 Kg daging ayam    Jumlah barang yang diminta (Kg)
Rp. 12.000,-    50
Rp. 13.000,-    40
Rp. 14.000,-    30
Rp. 15.000,-    20
Berdasarkan tabel tersebut, harga yang paling menguntungkan konsumen adalah…..
a. Rp. 12.000,-        b. Rp. 13.000,-        c. Rp. 14.000,-        d. Rp. 15.000,-
49.              P    Harga (P)            Kurva keseimbangan pada P1 terjadi jika…..
D                a. Harga barang naik, jumlah barang naik
S            b. Harga barang naik, jumlah barang turun
P1                       c. Harga barang turun, jumlah barang naik
P2                    E            d. Harga barang turun, jumlah barang turun

S            D
D          Q1      Q2    Jumlah (Q)
50.    Pada suatu pasar terjadi perubahan harga  keseimbangan. Akibatnya, terjadi kelebihan permintaan terhadap penawaran, sehingga penjual kekurangan barang. Hal ini menyebabkan …..
a. Harga naik                c. Jumlah barang ditambah
b. Harga turun                d. Keuntungan penjual meningkat



1.    Berikut yang merupakanbentukkerjasamaadalah ….
a.    Koersi        c. Bargaining
b.    Kompromi        d. Kontravensi
2.    Berikutmerupakan factor pendoronghubungan social yang merupakanhasratmenjadikandirinyaseperti orang lain disebutdengan ….
a.    Empati        c. Identifikasi
b.    Imitasi        d. Sugesti
3.    Hubungan social yang mampumewujudkanhiduprukun, damai, danharmonisadalahhubungan social denganjenis ….
a.    Asosiatif        c. Disosiatif
b.    Asimetris        d. Antarstatus
4.    Sebagaipedomandantingkahlakudalammasyarakatmerupakan … pranata social
a.    Fungsi        c. Tujuan
b.    Cirri-ciri        d. Latarbelakang
5.    Sebagaipranata social pastimempunyai cirri sebagaiberikut, kecuali….
a.    Symbol sendiri    c. Alatkelengkapan
b.    Umurlebih lama    d. Sanksi
6.    Lembaga yang bertugasmembuatperundang-undanganadalah ….
A.    Yudikatif        c. Legislative
B.    Eksekutif        d. Yudikatif
7.    Waktudantempatbelajardisesuaikandengansituasimerupakansalahsatu cirri pendidikan ….
a.    Formal        c. Informal
b.    Formalitas        d. Nonformal
8.    Berikutmerupakanpranata yang bertujuanuntukmemenuhikebutuhan social dankekerabatanadalahpranata ….
a.    Industry        c. Pemerintahan
b.    Perkawinan    d. Tempatkursus
9.    Sosialisasipertama yang dijalaniindividusemasakecildinamakan ….
a.    Internalisasi    c. Sosialisasisekunder
b.    Sosialisasipimer    d. Sosilisasitambahan
10.    Membentukwarga Negara yang cintatanah air merupakanfungsipranata ….
a.    Politik        c. Ekonomi
b.    Agama        d. Pendidikan
11.    Pengendalian social dengankekerasandapatditerapkankepadaorag yang melakukanperbuatan ….
a.    Kurangkomunikatif    c. Kurangsopan
b.    Tidakramah        d. Kejahatan
12.    Padasiswa yang seringmembolosditerapkanpengendalian social berupa ….
a.    Ejekan        c. Hukuman
b.    Teguran        d. Cemoohan
13.    Pengendalian social dengangosipdilakukansecara ….
a.    Negative        c. Terbuka
b.    Positif        d. Tertutup
14.    Seorangtokohmasyarakatdapatberperanmenjadilembagapengendalian social karenamempunyai ….
a.    Kekayaan        c. Keturunan
b.    Pengaruh        d. Kekebalan
15.    Memintabantuankepada orang lain untukmengatasimaslahdisebutdengan ….
a.    Intimidasi        c. Faraundulens
b.    Ostrasisme        d. Desas-desus
16.    Pengendalian social yang dilakukandengankekerasanataupaksaanmerupakanpengendalian social secara ….
a.    Preventif        c. Represif
b.    Persuasive        d. Kuratif
17.    Hubungan social yang positifmemilikisifat ….
a.    Memisahkan    c. Menghancurkan
b.    Mempersatukan    d. Menceraiberaikan
18.    Upayauntukmenyelesaikansuatukonflikdinamkan ….
a.    Kooperasi        c. Akomodasi
b.    Kompetisi        d. Kontravensi
19.    Aktivitas social yang berkaitandengan proses pengadaanbarangmerupakanbagiandaripranata ….
a.    Pendidikan        c. Keluarga
b.    Ekonomi        d. Politik
20.    Program untukmengatasipersebarantenagakerja yang tidakmerataadalah ….
a.    Urbanisasi        c. KB
b.    BLK        d. Transmigrasi
21.    Batasanusiakerja di Indonesia adalah ….
a.    10 tahuns.d. 65 tahun
b.    15 tahuns.d. 64 tahun
c.    17 tahuns.d. 70 tahun
d.    14 tahuns.d. 60 tahun
22.    Golonganproduktifbiasadisebutdengan ….
a.    Tenaga kerja    c. Angkatankerja
b.    Pekerja        d. Pengangguran
23.    System ekonomikomando juga seringdisebutdengan system ekonomi ….
a.    Kapitalis        c. Sosialis
b.    Imperialis        d. Marxis
24.    System ekonomi liberal bnayakdigunakanolehNegara ….
a.    Sosialis        c. Maju
b.    Berkembang    d. Asia
25.    Badanusaha yang dinilai paling cocokdengan UUD 1945 adalah ….
a.    BUMN        c. Swasta
b.    BUMD        d. Koperasi
26.    Pendirian BUMN sesuaidengan UUD 1945 pasal ….
a.    31            c. 33
b.    32            d. 34
27.    Pungutanresmidaripemerintahkepadaprodusentertentuatasbarang-barang yang diproduksiadalah ….
a.    Pajak        c. Cukai
b.    Retribusi        d. Subsidi
28.    Pajak yang dipungutolehpemerintahdaerahtingkat I disebutpajak ….
a.    Negara        c. Kabupaten
b.    Provinsi        d. Langsung

29.    faktor yang menyebabkanSoekarno Hatta menolakuntuksegeramemproklamasikankemerdekaan Indonesia adalah ……………..
a.    Soekarno-Hatta akanmembicarakanmasalahproklamasidalamrapat  PPKI  lebihdahulu
b.    Jepangbelumsepenuhnyamenyerahkankepadasekutu
c.    Bangsa Indonesia belumsiapuntukmempunyaipemerintahansendiri
d.    Pelaksanaanproklamasikemerdekaan Indonesia  membtuhkanbiaya yang besar

30.    Puncakperjuanganbangsa Indonesia di tandaidenganterjadinyaperistiwa …………..
a.    Proklamasikemerdekaan Indonesia 17 Agustus 1945
b.    Berlangsungnyasidang PPKI   I
c.    Disahkannyaundang-undangdasar RI
d.    Disahkannyapancasilasebagaidasarnegara Indonesia merdeka


31.    Yang merupakankebutuhanmanusiamenuruttingkatkepentingannyaadalah……
a.    Kebutuhan primer, sekunder, dantersier
b.    Kebutuhanjasmanidankebutuhanrohani
c.    Kebutuhansekarangdankebutuhan masa yang akandatang
d.    Kebutuhanindividu, kolektifdankebutuhan masa datang

32.    Perhatikanpernyataanberikut !
1). Mencarikeuntungan
2). Melayanikepentinganumum
3). Menambahdevisanegara
4). Mencegahterjadinyamonopoliswasta
5). Memberikesempatankerjabagipengangguran
6). Sebagaisumberpendapatannegara
Dari pernyataandiatas yang merupakantujuanberdirinya BUMN ditunjukkannomor :
a.    1,2, dan 3        b. 1,3 dan 6        c. 2, 4 dan 6        d. 4, 5 dan 6

33.    Badanusaha yang didirikanolehdua orang ataulebih, salahsatusebagaisekutuaktifdan yang lain sebagaisekutupasifdisebut……
a.    Firma                    b. Perseroan Terbatas
c. Persekutuan komanditer            d. Badanusahaperorangan

34.    Landasanidiildankonstitusionalkoperasi Indonesia adalah……
a.UU no. 25 tahun 1992            b. Pancasila dan UUD 1945
c. UUD 45 dansetiakawan        d. Pancasila dansetiakawan

35.    Perhatikanjenispasarberikutini!
1). Pasarbarangkonsumsi
2). Pasarharian
3). Pasarmonopoli
4). Pasarmingguan
5). Pasardaerah
6). Pasartahunan
Dari data diataspasarberdasarkanwaktubertemunyapenjualdanpembeliadalah….
a.1,2 dan 3        b. 1,3 dan 5        c. 2, 4 dan 6        d. 4, 5 dan 6

36.    1. Peningkatanmututenagakerja
2. Mendorongjiwawirausaha
3. meningkatkanmobilitastenagakerja
4. usahamengurangikesempatankerja
Dari komponen-komponendiatas, perananpemerintahdalampermasalahantenagakerjaadalah…..
a.    1 dan 3        b. 2 dan 4        c. 1,2 dan 3        d. Semuabenar

37.    Salah satucaraatauusahapemerintahmenurunkanangkatankerjadenganmelalui ….
a.    Program transmigrasi            b. Mendirikan BLK
c.    Pengadaankursus-kursus        d. Program KB danwajibbelajar 9 tahun

38.    Sistemperekonomian Indonesia adalahdemokrasiekonomiartinyaperekonomian…..
a.    Dilaksanakanolehpemerintahdanswastadanrakyat
b.    Dilaksanakanolehpemerintahdanswastauntukrakyat
c.    Dilaksanakandari, olehdanuntukrakyatdibawahpengawasanpemerintahhasilpemilihanrakyat
d.    Dilaksanakanolehdanuntukswastadanrakyatdenganpengawasanpemerintahhasilpemilihanrakyat

39.      Salah satucirisistemperekonomian Indonesia adalah …..
a.    Motif mencarilabaterpusatpadakepentingansendiri
b.    Alat – alatdanfaktor – faktorproduksidikuasaiolehnegara
c.    Pemerintahtidakturutcampursecaralangsungdalamkegiatanekonomi
d.    Warganegaramemilikikebebasandalammemilihpekerjaandanpenghidupan yang layak

40.       I.    Sistem free fight liberalisme
II.   Sistemetatisme
III. Monopoli
IV.Kolusi, Korupsi, Nepotisme
Ciri-cirinegatif yang harusdihindaridalampelaksanaandemokrasiekonomiadalah ….
a.     1 dan 2            c.    1, 2 dan 3
b.    3 dan 4            d.    2, 3 dan 4

41.       Yang tidaktermasukciri-ciripajakadalah ….
a.    Ada imbalanbalasjasasecaralangsungdarinegarakepadarakyat
b.    Pendapatannegaradaripajakdigunakanuntukpembelanjaannegara
c.    Pemungutanpajakberdasarkan UU
d.    Merupakaniuranwajibkepadanegara

42.    Pajakpertunjukanataupajakreklame, danpajakkendaraanbermotormerupakanjenispajak …..
a.    Pajaklangsung            c.    Pajakdaerah
b.    Pajaktaklangsung        d.    Pajaknegara

43.    Sesuaidenganhukumpermintaan, kurvapermintaanmemilikibentuk
a.    Miring darikananataskekiribawah
b.    Miring darikiribawahkekananatas
c.    Sejajardengansumbuvertikal
d.    Miring darikiriataskekananbawah
44.    Perhatikantabelpermintaandanpenawaranterhadaphargaberas per Kg dibawahini!
Hargaberas/ Kg    Permintaan    Penawaran
Rp  5.500,00    1.200    200
Rp  5.500,00    1.000    400
Rp  5.500,00    800    800
Rp  5.500,00    400    1.000
Rp  5.500,00    200    1.300

Hargakeseimbangandaritabeltersebutadalah …..

a.    Rp  5.500,00            c.    Rp  6.500,00
b.    Rp  6.000,00            d.    Rp  7.000,00

45.       Zaman praaksarasering kali diartikansebagai zaman
a.    Manusiasudahmengenaltulisan
b.    Manusiabelummengenaltulisan
c.    Munculnyamanusiapurba di mukabumi
d.    Terjadinyaperubahan-perubahan di mukabumi

46.       Salah satusemboyanbangsaEropadalampenjelajahansamudraadalah Glory yaitu
a.    Mencarikekayaan            c.    Menaklukkandunia
b.    Menyebarkan agama Nasrani        d.    Mencarikejayaan

47.    KewajibanrakyatPrianganuntukmenanam kopi pada masa Deandelsdisebut …
a.    Verplichteleverentie            c. contingenten
b.    Preangerstelsel            d. Cultuurstelsel

48.    Berikutini yang menjadipertimbanganataualasanJepangberjanjiakanmemberikankemerdekaankepadabangsa Indonesia di kelakkemudianhariadalah……..
a.    Agar bangsa Indonesia dapatmengaturpemerintahansendiri
b.    Jepangkesulitandalammenghadapiperlawananrakyat  Indonesia di berbagaidaerah
c.    Agar bangsa Indonesia maumembantujepangdalamperangmenghadapisekutu
d.    Jepangtelahmenyerahtanpasyaratkepadapihaksekutu

49.    Rancangandasarnegara yang miripdenganbunyibutir – butir Pancasila yang berlakusaatinidiambildari……..
a.    Pidato Ir. Soekarno            c. Piagam Jakarta
b.    Pidato Mr. Muhammad yamin        d. Batangtubuh UUD 1945

50.    Dalamsidang BPUPKI tanggal 1 Juni 1945 terdapathalkhususataukeistimewaandari Ir. Soekarno yang mengemukakanantaralain ………
a.    Berhasilmeningkatkansemangatperjuanganrakyat Indonesia
b.    Keinginanmenyatukanberbagaiorganisasipolitik di Indonesia
c.    Pandanganatauusulmengenaibentuknegara Indonesia
d.    Mengusulkannamabagidasarnegarayaitu Pancasila


1.    Perhatikan nama-nama berikut!
1) Ir. Soekarno            3) A.A. Maramis            5) H. Agus Salim
2) Abdul Latif            4) Mr. Muh. Yamin        6) Prof. Dr. Soepomo
Tokoh-tokoh yang termasuk dalam panitia Sembilan adalah…..
a. 1), 2), 3) dan 4)        b. 1), 2), 5) dan 6)    c. 1), 3), 4) dan 5)    d. 2), 3), 4) dan 5)
2.    Salah satu agenda dalam siding PPKI tanggal 18 AGustus 1945 adalah…..
a. Penetapan bentuk negar    a            c. Penyusunan anggaran dasar
b. Pembentukan MPRS                c. Pemilihan Presiden dan wakil presiden
3.    Para pemuda menemui Bung Karno dan Bung Hatta. Setelah mendengar bahwa Jepang menyerah kepada sekutu pada tanggal 15 Agustus 1945. Pada saat itu, tanggapan Bung Karno adalah…..
a. Segera memutuskan untuk memproklamasikan kemerdekaan
b. Segera mempersiapkan naskah proklamasi
c. Menghubungi laksamana Maida untuk berdiskusi
d. Tetap berpendapat bahwa Jepang masih berkuasasecara De Facto
4.    Proklamasi Kemerdekaan Indonesia yang dilaksanakan pada tanggal 17 Agustus 1945 adalah saat yang tepat mengingat Indonesia dalam keadaan Vacuum Of Power adalah…..
a. Kekosongan kekuasaan                c. Kekalahan Jepang
b. Kekurangan tentara                d. Kekuatan yang memuncak
5.    Mengapa terjadi pertempuran di berbagai daerah pada awal kemerdekaan…..
a. Bangsa Indonesia suka berperang        c. Penjajah ingin mempertahankan kekuasaannya
b. Tidak ada rasa persatuan di kalangan rakyat    d. Proklamasi tidak didukung oleh seluruh rakyat
6.    Pada awal terbentuknya RI, lembaga yang melaksanakan tugas MPR adalah…..
a. KNIP            b. BKR            c. PPKI            d. BPUPKI
7.    Pengesahan dan penetapan UUD 1945 serta pemilihan Presiden dan Wakil Presiden merupakan keputusan dalam siding…..
a. PPKI tanggal 18 Agustus 1945            c. PPKI tanggal 22 Agustus 1945
b. PPKI tanggal 19 AGustus 1945            d. BPUPKI tanggal 18 Agustus 1945
8.    Hasrat berproduksi mendorong seseorang melakukan hubungan sosial karena…..
a. Mampu meneruskan keturunan dari generasi ke generasi berikutnya
b. Hanya dengan berhubungan sosial seseorang mengenal lawan jenisnya yang akan
mengantarkannya ke perkawinan
c. Ingin dicintai oleh lawan jenisnya
d. Dengan hubungan sosial seseorang mendapatkan sahabat
9.    Berikut ini yang termasuk hubungan sosial antar kelompok adalah…..
a. Seorang polisi menilang seorang pengendara sepeda motor
b. Rapat antara pihak sekolah dengan wali murid guan menentukan besar uang gedung
c. Kepala sekolah memimpin rapat guru
d. Massa mengeroyok seorang pencuri
10.    Akomodasi merupakan hubungan sosial yang bersifat positif karena…..
a. Mengumpulkan banyak pihak
b. Menyelesaikan pertentangan tanpa menghancurkan pihak lawan
c. Mengajak anggota masyarakat untuk berempati dan bertoleransi
d. Memicu munculnya konflik antar kelompok
11.    Berikut ini yang termasuk hubungan sosial disosiatif adalah…..
a. Aksi demo menolak harga BBM berakhir dengan kerusuhan
b. Perkawinan campuran antar warga asing
c. Kerja bakti menyambut hari kemerdekaan Indonesia
d. Gotong royong menanam padi disawah
12.    Hadirnya pihak keluarga sebagai penasihat dalam perselisihan merupakan karakteristik dari…..
a. Abitration            b. Coersion        c. Mediator        d. Conciliation
13.    Salah satu faktor yang menyebabkan pranata sulit mengalami perubahan adalah…..
a. Internalisasi dan pengendalian sosial        c. Instituonalisasi dan tipifikasi
b. Interaksi dan sosialisasi                d. Habitualisasi dan tipifikasi
14.    Andika mendapat peringatan keras dari kepala sekolah karena sering membolos pada jam pelajaran Matematika. Apabila dilihat dari cakupannya pengendalian sosial diatas berupa pengawasan…..
a. Antar Individu                    c. Individu terhadap kelompok
b. Antar kelompok                    d. Kelompok antar individu

15.    Cara pengendalian sosial yang dikemukakan pertama kali oleh Lapiere adalah…..
a. Sosialisasi        b. Compulsion        c. Koersif        d. Tekanan sosial
16.    Salah satu jenis pengendalian sosial pada masyarakat modern yang merupakan produk badan eksekutif adalah…..
a. Denda ulang        b. Pencekalan        c. Somasi        d. Ganti rugi
17.    Pihak yang paling menentukan kegiatan produktif suatu perekonomian adalah…..
a. Angkatan kerja        b. Kesempatan kerja    c. Usia kerja        d. Tenaga kerja
18.    Permintaan tenaga kerja sering juga disebut…..
a. Angkatan kerja        b. Kesempatan kerja    c. Usia kerja        d. Pengangguran
19.    Awalnya Nina bekerja di pabrik garmen, oleh karena krisis ekonomi berkepanjangan, pabrik garmen tempat Nina bekerja terpaksa melakukan PHK. Nina termasuk salah satu karyawan yang kena PHK dan akhirnya menganggur. Nina termasuk pengangguran…..
a. Musiman            b.Friksional        c. Struktural        d. Siklikal
20.    Pengangguran struktural terjadi karena…..
a. Resesi ekonomi yang sering terjadi        c. Perubahan permintaan tenaga kerja secara berkala
b. Pertumbuhan ekonomi yang cepat         d. Perubahan kondisi dan politik
21.    Sektor usaha saat ini membutuhkan tenaga kerja yang siap pakai. Upaya pemerintah mengatasi hal tersebut dilakukan dengan cara…..
a. Menambah jumlah guru                c. Membangun gedung-gedung sekolah
b. Melaksanakan program pendidikan dasar        d. Memperbaiki kurikulum lebih apikatif
22.    Perhatikan kegiatan-kegiatan yang dilakukan pemerintah berikut ini!
1) Pendidikan formal        3) Program padat karya        5) Mengurangi jumlah penduduk
2) Perbaikan gizi masyarakat    4) Pembinaan wirausaha
Cara pemerintah untuk memperbaiki mutu tenaga kerja ditunjukkan nomor…..
a. 1) dan 2)            b. 2) dan 3)        c. 3) dan 4)        d. 4) dan 5)
23.    Munculnya system ekonomi campuran disebabkan oleh…..
a. Adanya kebebasan dalam bersaing dan berusaha
b. Adanya kelemahan system ekonomi sosialis dan system liberal
c. Semakin banyaknya campur tangan pemerintah dalam perekonomian
d. Semakin banyaknya negara yang menerapkan system liberal
24.    Kelemahan system ekonomi terpusat yaitu…..
a. Persaingan yang tidak sehat untuk mencapai kemakmuran
b. Monopoli sumber daya ekonomi oleh pemilik modal
c. Tidak ada kebebasan individu untuk berinisiatif
d. Mudah terjadi gejolak ekonomi
25.    Pada system ekonomi liberal, masyarakat akan terbagi menjadi dua golongan yaitu…..
a. Pemodal dan pemerintah                c. Pemodal dan buruh
b. Pemerintah dan buruh                d. Tradisional dan modern
26.    Dasar pelaksanaan system ekonomi Indonesia adalah UUD 1945 pasal…..
a. 32            b. 33            c. 34            d. 31
27.    Salah satu ciri negative yang harus dihindari oleh system perekonomian Indonesia adalah…..
a. Potensi setiap masyarakat harus disalurkan kepada pemerintah
b. Tidak adanya perusahaan swasta dalam perekonomian
c. Kebebasan individu yang merugikan orang lain
d. Setiap warga negara mentaati peraturan pemerintah
28.    Salah satu kelemahan system ekonomi di Indonesia adalah…..
a. Sangat besarnya peran pemerintah sehingga tidak ada inisiatif masyarakat
b. Terjadinya monopoli sumber ekonomi
c. Adanya perusahaan-perusahaan untuk negara
d. Adanya unit ekonomi kerakyatan yang berdasarkan azas kekeluargaan
29.    Ketika melewati jalan tol, kebdaraan jalan tol harus membayar tiket. Sejumlah uang yang dikeluarkan pengguna jalan tersebut termasuk pembayaran…..
a. Pajak            b. Iuran            c. Retribusi        d. Sumbangan
30.    Pajak penghasilan (PPh) diatur dalam…..
a. Undang-undang Nomor 17 Tahun 2000        c. Undang-undang Nomor 12 Tahun 1985
b. Undang-undang Nomor 18 Tahun 2000        d. Undang-undang Nomor 12 Tahun 1994
31.    Berikut ini beberapa macam pajak!
1) Pajak reklame        3) Pajak hotel            5) Bea Materai
2) Pajak ekspor        4) Pajak kendaraan bermotor
Dari keterangan diatas, yang termasuk pajak daerah adalah…..
a. 1), 2) dan 3)        b. 1), 3) dan 4)        c. 1), 3) dan 5)        d. 2), 3) dan 4)
32.    Permintaan suatu barang di pasar akan bertambah jika…..
a. Selera masyarakat tidak berubah            c. Harga barng subtitusi menurun
b. Produksi barang beraneka ragam            d. Harga barang subtitusi naik
33.    Perhatikan faktor-faktor yang mempengaruhi permintaan berikut!
1) Penghasilan masyarakat bertambah        4) Selera masyarakat tidak berubah
2) Harga barang turun                5) Harga dimungkinkan naik pada masa depan
3) Harga barang pengganti turun
Faktor-faktor diatas yang menaikkan permintaan adalah…..
a. 1), 2) dan 3)        b. 1), 3) dan 5)        c. 1), 2) dan 5        d. 3), 4) dan 5)
34.    Perhatikan table berikut ini!
Harga 1 Kg daging ayam    Jumlah barang yang diminta (Kg)
Rp. 12.000,-    50
Rp. 13.000,-    40
Rp. 14.000,-    30
Rp. 15.000,-    20
Berdasarkan tabel tersebut, harga yang paling menguntungkan konsumen adalah…..
a. Rp. 12.000,-        b. Rp. 13.000,-        c. Rp. 14.000,-        d. Rp. 15.000,-
35.              P    Harga (P)            Kurva keseimbangan pada P1 terjadi jika…..
D                a. Harga barang naik, jumlah barang naik
S            b. Harga barang naik, jumlah barang turun
P1                    c. Harga barang turun, jumlah barang naik
P2      E                d. Harga barang turun, jumlah barang turun

S            D
D          Q1      Q2    Jumlah (Q)
36.    Pada suatu pasar terjadi perubahan harga  keseimbangan. Akibatnya, terjadi kelebihan permintaan terhadap penawaran, sehingga penjual kekurangan barang. Hal ini menyebabkan …..
a. Harga naik                c. Jumlah barang ditambah
b. Harga turun                d. Keuntungan penjual meningkat

37.    Panglima tentara tertinggi jepang untuk kawasan Asia Tenggara berkedudukan di ….
a.    Dalath        c. Jakarta
b.    Tarakan        d. Bukittinggi
38.    Berikut merupakan orang jepang yang menjadi anggota BPUPKI adalah ….
a.    Kuniaki Kuiso    c. Ichibangase
b.    Tadashi Maeda    d. Hideki Tojo
39.    Siding pertama BPUPKI berlangsung ….
a.    28 Mei-1 Juni 1945
b.    28 Mei-2 Juni 1945
c.    29 Mei-1 Juni 1945
d.    29 Mei-7 Juni 1945

40.    Ir. Soekarno pada masa persiapan kemerdekaan pernah menjabat sebagai ketua ….
a.    Peta        c. PPKI
b.    KNIP        d. BPUPKI


41.    Pendapatan keluarga rumah tangga umumnya berasal dari….
a. Usaha sendiri dan gaji                c. Usaha sendiri dan subsidi pemerintah
b. Warisan orang tua dan gaji            d. Gaji dan subsidi pemerintah
42.    Ciri-ciri rumah tangga keluarga yang mengkonsumsi barang/jasa secara rasional adalah…..
a. Tidak membeli barang/jasa sama sekali        c. Membeli barang/jasa yang benar-benar dibutuhkan
b. Membeli seluruh barang/jasa yang ada        d. Membeli barang/jasa yang sedang dibutuhkan
43.    Suatu pasar yang dinamakan pasar konkret karena…..
a. Mendapat tempat usaha dan jasa-jasa penduduk
b.Kenyataannya terdapat orang, yaitu antar penjual dan pembeli
c. Dikelola oleh pemerintah daerah yang diikuti dengan retribusi
d. Kenyataannya di situ terdapat bermacam-macam barang yang diperjual belikan
44.    Pendirian pasar modal, pembentukan badan pelaksana pasar modal dan pembentukan PT. Danaraksa sesuai dengan keputusan Presiden….
a. Nomor 50 tahun 1976                c. Nomor 52 tahun 1976
b. Nomor 51 tahun 1976                d. Nomor 53 tahun 1976
45.    Pasar modal dan pasar tuna karya merupakan jenis dari pasar….
a. Daerah            b. Harian        c. Faktor produksi        d. Distribusi
46.    Organisasi pergerakan nasional Indonesia yang mengeluarkan manifesto politik tahun 1925 adalah…..
a. Indische Partij                    c. Partai nasional Indonesia
b. Perhimpunan Indonesia                d. Partai Indonesia raya
47.    Mengganti tanaman hutan yang rusak atau mati dengan tanama baru disebut…..
a. Rehabilitasi        b. Reboisasi        c. Penghijauan            d. Intensifikasi
48.    Segala kegiatan yang sifatnya menguntungkan negara akan dikelola oleh….
a. BUMS            b. Koperasi        c. BUMN            d. Usaha dagang
49.    Sifat keanggotaan koperasi Indonesia adalah…..
a. Sukarela            b. Mengikat        c. Demokratis            d. Bebas

50.    Koperasi yang kegiatannya menyediakan kebutuhan hidup sehari-haribagi para anggotanya adalah koperasi….
a. Konsumsi        b. Serba usaha        c. Simpan pinjam        d. Produksi

Soal SMP IPS Kelas 8 Semester 8 Tahun 2016

1.    Gambaran tentang seluruh atau sebagian permukaan bumi pada bidang datar dengan skala tertentu disebut…..
a. Peta            b. Globe        c. Sketsa        d. Geografi
2.    Negara Indonesia terkenal dengan sebutan negara agraris, pernyataan tersebut menunjukkan bahwa…..
a. Kebanyakan masyarakat Indonesia hidup sebagai petani
b. Hampir seluruh masyarakat bermata pencaharian sebagai pedagang
c. Sebagian besar wilayah Indonesia berupa daratan
d. Mata pencaharian penduduk Indonesia kebanyakan sebagai pelaut
3.    Unsur alam yang tidak bisa digambarkan pada sebuah peta yaitu…..
a. Laut            b. Dataran rendah    c. Pegunungan        d. Udara
4.    Pengolahan tanah secara terasiring berfungsi untuk mencegah…..
a. Kerusakan tanah                    c. Banjir
b. Hilangnya unsur hara                d. Tanah longsor
5.    Agama Hindu masuk ke Indonesia melalui…..
a. Perdagangan        b. Penaklukan        c. Peperangan        d. Pemaksaan
6.    Letak Indonesia berdasarkan garis lintang dan garis bujur termasuk dalam penentuan letak…..
a. Geografis        b. Klimatologis        c. Astronomis        d. Geologis
7.    Dibawah ini yang merupakan aspek kimiawi yang berkaitan dengan sifat tanah subur adalah…..
a. Cukup mengandung unsur air            c. Banyak mengandung unsur hara
b. Struktur tanahnya baik                d. Pemanfaatannya sangat optimal
8.    Kemampuan penduduk dalam memenuhi kebutuhan utamanya disebut…..
a. Kualitas penduduk                c. Mobilitas penduduk
b. Kuantitas penduduk                d. Aktifitas penduduk
9.    Jumlah penduduk Indonesia pada tingkat dunia peringka ke…..
a. 2            b. 3            c. 4            d. 5
10.    Pembangunan kota modern dengan seluruh aspek penunjangnya akan menciptakan kondisi lingkungan…..
a. Abiotik            b. Budaya        c. Alam            d. Sosial
11.    Aktifitas manusia dalam mengolah tanah secara serampangan akan mengakibatkan gejala yang merugikan di bidang pertanian yaitu terbentuknya…..
a. Lahan kritis        b. Lahan potensial    c. Lahan optimal    d. Lahan maksimal
12.    Pelaksanaan politik etis didasarkan atas Trilogi yang diusulkan oleh…..
a. Van Deventer        b. Max Havelar        c. Douwes Dekker    d. Multa Tuli
13.    Sisi positif kebijakan ekonomi Raffles di Indonesia adalah…..
a. Rakyat bebas mengusahakan tanaman yang menguntungkan sesuai dengan ketrampilannya
b. Rakyat tidak lagi dibebani pajak
c. Seluruh masyarakat mendapat kopling tanah dari pemerintah
d. Pemerintah menyediakan bibit tanaman komoditi ekspor
14.    Untuk melumpuhkan Pangeran Diponegoro, Belanda menggunakan taktik…..
a. Benteng Stelsel        b. Blockode        c. Pagar betis        d. Devide et Impera
15.    Gerakan rakyat yang timbul atas kepercayaan bahwa seorang tokoh akan datang untuk membebaskan orang dari segala penderitaan dan kesengsaraan disebut…..
a. Gerakan Samin                    c. Gerakan ratu adil
b. Gerakan keagamaan                d. Gerakan wahabiah
16.    Trilogi Van Deventer meliputi tiga sector yaitu…..
a. Emigrasi, Irigasi dan Edukasi            c. Transmigrasi, Irigasi dan Edukasi
b. Migrasi, Irigasi dan Edukasi            d. Imigrasi, Irigasi dan Asosiasi
17.    Pendiri Sekolah kebangsaan TAMAN SISWA adalah…..
a. Kyai. Samanhudi                c. Ki Hajar Dewantara
b. Moh. Syafei                    d. Danudirjo Setiabudi
18.    Secara psikologis sebab utama terjadinya penyimpangan sosial dari unsur pribadi manusia adalah adanya…..
a. Kepribadian ganda                c. Kepribadian utuh
b. Kepribadian rusak                d. Kepribadian menyimpang
19.    Pola penyimpangan dalam masyarakat yang hanya dilakukan seseorang tanpa melibatkan orang lain dalam jenis penyimpangan…..
a. Individu            b. Campuran        c. Kelompok        d. Beriringan
20.    Kebutuhan primer dibedakan dengan kebutuhan sekunder berdasarkan…..
a. Sifatnya                        c. Tingkat kepentingannya
b. Tujuan penggunaannya                d. Waktu penggunaannya
21.    Perhatikan barang-barang berikut ini!
1) Buku            3) Gula            5) Air pada waktu hujan
2) Sinar matahari        4) Udara        6) Televisi
Berdasarkan data diatas yang merupakan benda ekonomi adalah nomor…..
a. 1), 2) dan 3)        b. 1), 3) dan 6)        c. 2), 4) dan 5)        d. 2), 3) dan 6)
22.    Tujuan utama Koperasi adalah…..
a. Berdasarkan kekeluargaan            c. Mencari keuntungan
b. Meningkatkan kesejahteraan anggota        d. Menyerap tenaga kerja
23.    Apabila penghasilan kecil, kita harus panda-pandai memilih kebutuhan yang perlu dipenuhi sehingga terjadi…..
a. Keseimbangan antara kebutuhan konsumsi dan penghasilan keluarga
b. Mengajukan penambahan gaji
c. Perlu peningkatan kesejahteraan
d. Mendahulukan kebutuhan yang terpenting
24.    Salah satu ciri yang menonjol dalam pasar konkret adalah…..
a. Penjual dan pembeli berkontak langsung        c. Transaksi bisa lewat internet
b. Tidak memerlukan tempat khusus        d. Harga dapat berubah-rubah setiap waktu
25.    Perusahaan-peruhaan yang bergerak dalam bidang cabang-cabang produksi yang penting dan menguasai hajat hidup orang banyak di Indonesia dikuasai oleh…..
a. Pihak swasta        b. Negara        c. Koperasi        d. Umum
26.    Pada masa pendudukan Jepang terjadi perlawanan di berbagai daerah. Hal tersebut disebabkan karena…..
a. Kedatagan Jepang di Indonesia ditentang rakyat
b. Pejuang tahu bahwa posisi Jepang di dunia sulit
c. Para pejuang berusaha merebut kemerdekaan
d. Tindakan Jepang di Indonesia sudah diluar batas kemanusiaan
27.    Jepang melakukan pemerasan tenaga manusia Indonesia untuk membangun berbagai sarana melalui…..
a. Kamikaze        b. Harakiri        c. Rodi            d. Romusha
28.    Proklamasi kemerdekaan Indonesia yang dilaksanakan tanggal 17 Agustus 1945 adalah saat yang tepat, mengingat Indonesia dalam keadaan Vacum Of Power arti dari Vacuum Of Power adalah…..
a. Kekosongan kekuasaan                c. Kekalahan Jepang
b. Kekurangan tentara                d. Kekuatan yang memuncak
29.    Maksud naskah Proklamasi Kemerdekaan yang autentik adalah…..
a. Teks proklamasi tulisan tangan dari Ir. Soekarno
b. Teks yang diusulkan oelh Ahmad Subarjo dan Ir. Soekarno
c. Naskah yang diusulkan oleh Muhammad Hatta
d. Naskah yang diketik Sayuti Melik dan ditandatangani Soekarno Hatta
30.    Keadaan Jepang semakin terjepit dengan dijatuhkannya bom atom di kota…..
a. Tokyo            b. Dalath        c. Canton        d. Hiroshima
31.    Persaingan yang sehat diantara klub basket untuk menjadi juara sifatnya…..
a. Asosiatif            b. Asimilatif        c. Kompetitif        d. Komparatif
32.    Pranata sosial merupakan suatu sistem pola-pola pemikiran dan pola perilaku yang terwujud melalui…..
a. Situasi kehidupan                c. Aturan perilaku
b. adat istiadat                    d. Aktivitas kemasyarakatan
33.    Untuk menanamkan sikap sopan santun terhadap anak diperlukan pranata…..
a. Perkawinan        b. Ekonomi        c. Peradilan        d. Pendidikan
34.    Secara umum proses awal pengendalian sosial tindakan yang digunakan merupakan tindakan…..
a. Kelompok        b. Masyarakat        c. Diri            d. Lingkungan
35.    Tujuan utama yang dilakukan individu untuk mengendalikan diri adalah agar tidak menimbulkan…..
a. Penindasan antar masyarakat            c. Konflik lebih luas
b. Imperialisme baru                d. Degradasi lingkungan
36.    Masalah ketenaga kerjaan di Indonesia diatur dalam UUD 1945 pasal…..
a. 23            b. 27            c. 33            d. 34
37.    Untuk menyerap banyak tenaga kerja maka dikembangkan usaha…..
a. Padat karya        b. Padat modal        c. Padat teknologi    d. Padat informasi
38.    Landasan perekonomian Indonesia ditentukan dalam…..
a. UUD 1945 pasal 33                c. Undang-Undang
b Pembukaan UUD 1945                d. Pancasila sila ke-4
39.    Badan usaha yang didirikan oleh dua orang atau lebih dengan menggunakan nama bersama disebut…..
a. Firma                        c. Perseroan terbatas
b. Persekutuan                    d. Persekutuan Komanditer
40.    Karcis masuk tempat wisata, iuran parkir, iuran sampah adalah contoh dari…..
a. Pajak            b. Sumbangan        c. Retribusi        d. Iuran
41.    Permintaan tercipta apabila pembeli memiliki…..
a. Keinginan membeli barang dan jasa yang diinginkan
b. Kesediaan membayar barang atau jasa yang dibelinya
c. Kesempatan bertemu dengan penjual
d. Keinginan membeli dan kesediaan membayar barang atau jasa yang dibelinya
42.    Hukum permintaan berbanding terbalik dengan harga artinya…..
a. Jika harga naik permintaan turun            c. Jika harga naik penawaran tetap
b. Jika harga naik permintaan naik            d. Jika harga turun permintaan tetap
43.    Harga keseimbangan mempunyai pengertian….
a. Harga yang ditetapkan pemerintah        c. Harga yang diinginkan produsen
b. Harga yang diinginkan konsumen        d. Harga yang terbentuk melalui mekanisme pasar
44.    Harga barang yang naik dan diikuti oleh kenaikan jumlah barang yang ditawarkan adalah sesuai…..
a. Hukum ekonomi                    c. Hukum penawaran
b. Ceteris Paribus                    d. Hukum permintaan
45.    Iuran yang dikenakan pada minyak tanah, bensin, minuman keras, rokok atau tembakau adalah…..
a. Pajak            b. Sumbangan        c. Retribusi        d. Cukai
46.    Suatu barang yang diperoleh dengan mengeluarkan biaya atau melakukan pengorbanan adalah termasuk barang……
a. Bebas            b. Ekonomi        c. Komplementer    d. Substitusi
47.    Salah satu ciri sistem demokrasi ekonomi yang harus dihindari adalah Free Fight Liberalisme yang artinya…..
a. Sebagian masyarakat tersingkirkan
b. Pemerintah tidak dapat mengawasi perekonomian
c. Adanya monopoli kelompok masyarakat tertentu
d. Menumbuhkan ekspoitasi manusia

48.    Tokoh-tokoh berikut yang memberikan pendapatnya mengenai dasar-dasar Negara Indonesia, kecuali ….
a.    Soeomo        c. Ir. Soekarno
b.    Moh. Hatta    d. Muh. Yamin
49.    Tokoh yang mendapatkan tugas mengetik naskah proklamasi adalah ….
a.    Sukarni        c. Sajoeti Malik
b.    Moh. Hatta    d. Ir. Soekarno

50.    Tugas untuk membawa ir. Soekarno-Moh. Hatta ke Rengasdengklok dipercayakan pada ….
a.    Singgih    c. Chairul Saleh
Subeno    d. Sutan Syahrir


1.    Jika kelembapan udara di suatu wilayah tinggi keadaan cura hujannya ….
a.    Rendah        b. Tinggi        c. Sangat rendah        d. Sedang
2.    Berdasarkan letak astronomisnya, seluruh wilayah Indonesia beriklim ….
a.    Dingin        b. Sedang        c. Subtropics            d. Tropis
3.    Berikut yang bukan jenis fauna Indonesia tengah atau peralihan adalah ….
a.    Babi rusa        b. Kangguru        c. Anoa            d. Komodo
4.    Tanah hasil pelapukan bahan padat dan cair yang yang dimuntahkan gunung beapi disebut tanah ….
a.    Alluvial        b. Regosol        c. Humus            d. Laterit
5.    Musim yang menjadi pembatas antara musim hujan dan musim kemarau disebut ….
a.    Semi        b. Gugur        c. Panas            d. Pancaroba
6.    Wilayah Indonesia terletak antara dua benua, yaitu ….
a.    Asia dan Australia                c. Asia dan Amerika
b.    Afrika dan Asia                d. Australia dan Amerika
7.    Kota di Indonesia yang dijuluki ‘Kota Khatulistiwa’ adalah ….
a.    Makassar        b. Kutai        c. Pontianak            d. Palu
8.    Berikut ini, suku bangsa yang ada di Indonesia, kecuali suku ….
a.    Adonara        b. Moro        c. Bawean            d. Bajo
9.    Tanaman yang cocok dibudidayakan di daerah dataran rendah adalah ….
a.    Palawija        b. Teh            c. Buah-buahan        d. Kopi
10.    Garis yang terbentang dari kutub utara dan kutub selatan disebut garis ….
a.    Bujur        b. Lintang        c. Weber             d. Wallace
11.    Diantara factor pendorong angka kelahiran sangat tinggi adalah ….
a.    Kawin usia mudah                c. Program KB
b.    Wanita karier                d. Menunda perkawinan
12.    Jika suatu Negara mempunyai angka kematian 500 orang dalam setahun maka angka tersebut termasuk kriteria ….
a.    Tinggi         b. Sedang        c. Standard            d. Rendah
13.    Bentuk gambar piramida penduduk muda atau ekspansif adalah seperti ….
a.    Sarang lebah    b. Batu nisan        c. Limas            d. Batu makam
14.    Tenaga kerja Indonesia yang bekerja di Arab Saudi merupakan contoh ….
a.    Migrasi         b. Imigrasi        c. Emigrasi            d. Rulalisasi
15.    Sensus penduduk di Indonesia diadakan setiap …. tahun sekali.
a.    Dua        b. Lima        c. Delapan            d. Sepuluh
16.    Piramida penduduk muda digambarkan dalam bentuk ….
a.    Limas        b. Prisma        c. Granat            d. Batu nisan
17.    Cara untuk memperoleh data kependudukan yang paling dapat dipercaya kebenarannya dan lengkap adalah ….
a.    Survey        b. Registrasi        c. Sensus            d. Penelitian
18.    Jumlah penduduk dalam setiap wilayah seluas satu kilometre persegi merupakan pengertian dari …. penduduk.
a.    Survey        b. Kepadatan        c. Registrasi            d. Mobilitas
19.    Perpindahan penduduk dari wilayah satu ke wilayah yang lain disebut ….
a.    Mortalitas        b. Fertilitas        c. Natalitas            d. Migrasi
20.    Piramida penduduk Indonesia menunjukan golongan penduduk muda sebab sebagian besar penduduk berusia ….
a.    0-14 tahun        b. 15-40 tahun        c. Tua                d. Muda
21.    Air sangat dibutuhkan karena ….
a.    Sumber kehidupan    b. Harus beli        c. Sangat penting    d. Sulit memperoleh air
22.    Terjadinya gempa bumi disebabkan oleh ….
a.    Tenaga eksogen        b. Tenaga endogen    c. Sedimentasi        d. Perilaku manusia
23.    Organisme yang tidak dapat mengolah makanan sendiri dan bergantung kepada organisme lainnya disebut ….
a.    Konsumen        b. Produsen            c. Pengurai        d. Sel
24.    Hutan di daerah pegunungan menyebabkan udara menjadi segar. Hal ini merupakan fungsi hutan ….
a.    Orologis        b. Hidrologis        c. Klimatologis        d. Strategis
25.    Lapisan udara yang menyelubungi bumi terdiri atas kumpulan sebagai gas disebut ….
a.    Karbondioksida    b. Oksigen        c. Atmosfer            d. Nitrogen
26.    Berbagai aturan yang mengatasi hubungan antar individu dengan lingkungannya termasuk unsur lingkungan …
a.    Fisik        b. Social budaya    c.biotik            d. Abiotik
27.    Zat materi yang dapat menyebabkan pencemaran disebut ….
a.    Polusi        b. Polutan        c. Pencemaran            d. Pengotoran
28.    Republik Bataaf berdiri sebagai bagian dari Negara ….
a.    Belanda        b. Inggris        c. Prancis            d. Belgia
29.    Ketika VOC dibubarkan maka nasib Indonesia sebagai wilayah jajahannya adalah ….
a.    Dibiarkan saja    b. Dijajah inggris    c. Dikuasai Republic Bataaf    d. Direbut Spanyol
30.    Mengadakan monopoli perdagangan beras dan menerapkan system kerja rodi meupakan tindakan Dendles selama memerintah Pulau Jawa dalam bidang ….
a.    Politik        b. Ekonomi        c. Pendidikan             d. Social
31.    Tanaman wajib yang terakhir kali dihapuskan pada tahun 1870 adalah ….
a.    Cengkih        b. Kopi        c. Teh                d. Tembakau
32.    Salah satu jenderal Belanda yang gugur dalam Perang Aceh adalah Jenderal ….
a.    Van Swellen    b. J.H.R. Kohler    c. Van Heutz            d. de Kock
33.    Bagi masyarakat minangkabau, pembaru islam mereka sebut “padri” karena mereka berpakaian serba ….
a.    Putih-putih    b. Hitam-hitam    c. Merah-merah        d. Biru-biru
34.    Akibat politik etis di Indonesia muncul golongan masyarakat ….
a.    Abangan        b. Pamong praja    c. Terpelajar            d. Bangsawan
35.    Fransiscus Xaverius berasal dari Negara ….
a.    Belanda        b. Portugis        c. Vatikan            d. Spanyol
36.    Boedi Utomo didirikan oleh mahasiswa ….
a.    UI            b. STOVIA        c. ITB                d. IPB
37.    Nasionalisme dapat dipandang sebagai suatu paham kebangsaan yang diwujudkan dalam kestiaan pada ….
a.    Diri sendiri    b. Suku sendiri    c. Orang lain            d. Negara
38.    Sanksi bagi orang yang telah melakukan penyimpangan positif adalah …..
a.    Celaan        b. Kucilan        c. Hukuman penjara        d. Pengasingan
39.    Berita yang menyebar secara cepat dan tidak berlandaskan pada fakta disebut ….
a.    Teguran        b. Hukuman        c. Pelecehan            d. Gossip
40.    Alat pengendalian social yang paling efektif, tegas, dan nyata sanksinya adalah ….
a.    Gossip        b. Hukuman        c. Agama            d. Pendidikan
41.    Tindak kekerasan yang sering ditonton melalui televisi dapat mengakibatkan terjadinya ….
a.    Penyimpangan    b. Pendidikan        c. Pengendalian        d. Pergaulan
42.    Contoh penyimpangan social yang dikatagorikan sebagai tindakan criminal adalah ….
a.    Pengemis        b. Orang gila        c. Tuna susila            d. Koruptor
43.    Berikut ini yang termasuk sumber daya abiotik adalah ….
a.    Hewan        b. Tumbuhan        c. Udara            d. Binatang
44.    Contoh modal konkret adalah ….
a.    Gedung        b. Hak paten         c. Keahlian            d. Nama baik
45.    Untuk menggunakan sumber daya manusia atau tenaga kerja perlu adanya pengorbanan. Maksud pengorbanan disini adalah ….
a.    Biaya        b. Gaji            c. Laba                d. Sewa
46.    Keadaan di mana manusia dapat memenuhi segala kebutuhan disebut ….
a.    Kaya         b. Damai        c. Makmur            d. Konglomerat
47.    Kebutuhan akan barang mewah disebut juga akan kebutuhan ….
a.    Primer        b. Sekunder        c. Tersier            d. Rohani
48.    Kebutuhan yang sifatnya psikis atau kejiwaan adalah kebutuhan ….
a.    Jasmani        b. Rohani        c. Individu            d. Kelompok
49.    Menabung adalah salah satu cara untuk mempersiapkan kebutuhan ….
a.    Primer         b. Sekunder        c. Tersier            d. Yang akan datang
50.    Pintalan benang yang akan dproses menjadi kain, termasuk barang ….
a.    Mentah        b. Setengah jadi    c. Jadi                d. Subtitusi

Kunci jawaban:
1.B    6.A    11.A    16.A    21.A    26.B    31.B    36.B    41.A    46.C
2.D    7.C    12.A    17.A    22.B    27.B    32.C    37.D    42.D    47.C
3.B    8.B    13.C    18.B    23.A    28.C    33.A    38.A    43.C    48.B
4.B    9.A    14.C    19.D    24.C    29.C    34.C    39.D    44.A    49.D
5.D    10.A    15.D    20.A    25.C    30.B    35.B

Soal IPS Kelas 8 SMP Semester 1

1.    Pusat timbulnya gempa bumi dinamakan…..
a. Episentrum        b. Hiposentrum        c. Tsunami        d. Pleistosenta
2.    Gempa yang terjadi di Aceh dan Daerah Istimewa Yogyakarta termasuk jenis gempa…..
a. Tektonik            b. Vulkanik        c. Terban        d. Runtuhan
3.    Ilmu yang mempelajari asal kejadian bumi struktur dan komposisinya disebut…..
a. Antropologi        b. Geologi        c. Sejarah        d. Arkeologi
4.    Berikut yang bukan merupakan bagian zaman batu adalah…..
a. Paleolitikum        b. Mesolitikum        c. Arkoikum        d. Neolitikum
5.    Sebagai Homoeconomicus dalam memenuhi kebutuhan manusia selalu bersikap…..
a. Sosial            b. Individu        c. Kolektif        d. Hemat
6.    Suatu proses yang dapat membantu individu melalui proses belajar dan penyesuaian diri agar ia dapat berperan dalam kelompoknya dinamakan proses…..
a. Adaptasi            b. Sosialisasi        c. mitasi        d. Interaksi
7.    Motif ekonomi sangat penting, sebab dapat…..
a. Mendorong semangat bekerja            c. Menjadi pedoman kegiatan ekonomi
b. Menambah kewaspadaan                d. Menjadi pedoman setiap tindakan
8.    Peta yang digunakan bapak dan Ibu guru mengajar di kelas, berdasarkan bentuknya termasuk peta…..
a. Peta umum        b. Peta digital        c. Peta timbul        d. Peta datar
9.    Unsur alam yang tidak bisa digambarkan pada sebuah peta yaitu…..
a. Laut            b. Dataran rendah    c. Pegunungan        d. Udara
10.    Pengaruh Hindu-Budha dalam bidang politik dan pemerintahan terlihat pada…..
a. Pemerintahan yang berbentuk kerajaan        c. Pemerintahan yang berbentuk kesultanan
b. Agama Hindu dijadikan agama negara        d. Digunakan huruf pallawa dan bahasa sansakerta
11.    Pengaruh budaya India yang tidak selaras dengan kehidupan sosial di Indoensia adalah…..
a. Berlangsungnyan sistem pemerintahan kerajaan
b. Ditetapkan peraturan sistem kasta
c. Berkembangnya seni bangunan candi
d. Berkembangnya bahasa dan tulisan pallawa
12.    Kemampuan untuk menciptakan sesuatu yang baru disebut…..
a. Intuisi            b. majinasi        c. Kreativitas        d. Inisiatif
13.    Suatu tindakan untuk membuat perubahan-perubahan atas sesuatu yang sudah ada sekarang ini disebut…..
a. Inisiatif            b. Inovasi        c. Invensi        d. Ekstensi
14.    Kegiatan yang mendorong kreasi seseorang adalah…..
a. Bermain            b. Bekerja        c. Membaca        d. Menonton
15.    Letak Indonesia yang berdasarkan garis lintang dan garis bujur termasuk dalam penentuan letak…….suatu negara.
a. Geografis        b. Klimatologis         c. Astronomis        d. Geologis

16.    Pengertian garis lintang pada permukaan bumi yang paling tepat adalah…..
a. Garis khayal yang membagi wlayah Indonesia pada tiga daerah waktu
b. Garis khayal yang menghubungkan wilayah dengan letak ketinggian berbeda
c. Garus khayal yang membujur dari utara ke selatan
d. GAris khayal yang menghubungkan pada bola bumi yang melintang dari barat-timur secara horizontal
17.    Pengertian penduduk Indonesia di bawah ini yang paling tepat ditunjukkan pada pernyataan…..
a. Semua orang yang berasal dari keluarga Indonesia
b. Semua orang yang sudah tinggal di ndonesia selama 3 bulan
c. Semua orang yang bertempat tinggal di wilayah Indonesia pada saat sensus dan menetap selama 6 bulan
d. Semua orang yang dilahirkan di Indonesia dan memperoleh akta kelahiran Indonesia
18.    Kawasan hutan yang melindungi untuk mempertahankan atau melestarikan jenis flora tertentu agar dapat berkembang biak secara alami termasuk dalam upaya pelestarian lingkungan dengan menggunakan…..
a. Suaka margasatwa    b. Kebun raya        c. Taman safari        d. Cagar alam
19.    Kualitas penduduk berkaitan kondisi ekonomis masyarakat terlihat jelas manakala kita mengamati permasalahan…..
a. Tingkat penghasilan    b. Tingkat pendidikan    c. Tingkat kesehatan    d. Mata pencaharian
20.    Faktor nondemografi yang mempengaruhi pertumbuhan penduduk di bawah ini adalah…..
a. Pendidikan dan kesehatan            c. Migrasi dan kelahiran
b. Penghasilan dan keterjangkauan            d. Kematian dan imigrasi
21.    Pengertian lingkungan hidup adalah…..
a. Kesatuan ruang dengan sebuah benda yang ada di permukaan bumi yang mempengaruhi kondisi
ekonomi masyarakat.
b. Kesatuan ruang dengan seluruh benda yang ada diseluruh muka bumi dan saling berkaitan dengan
aktivitas makhluk lain.
c. Kesatuan ruang dengan seluruh benda yang ada di seluruh muka bumi yang rentan terpengaruh banyak
perubahan dan modernisasi.
d. Kesatuan ruang dengan seluruh benda, daya, keadaan dan makhluk hidup termasuk manusia yang
mempengaruhi peri kehidupan dan kesejahteraan manusia serta makhluk hidup lain.
22.    Perhatikan tabel komponen penyusun lingkungan berikut ini.
1    Gravitasi    5    Atmosfer
2    Harimau    6    Tumbuhan
3    Sinar matahari    7    Iklim
4    Tundra    8    Bahan kimia
Lingkungan abiotik berdasarkan tabel diatas ditunjukkan pada komponen nomor…..
a. 1), 2), 3) dan 4)        b. 5), 6), 7) dan 8)    c. 1), 3), 5) dan 7)    d. 2), 4), 6) dan 8)
23.    Contour farming merupakan pola penanaman pada lahan pertanian dengan disesuaikan…..
a. Daerah aliran sungai    b. Kemiringan terang    c. Jumlah curah hujan    d. Ketinggian tanah
24.    Akibat pembuatan jalan Anyer sampai Panarukan bagi rakyat Indonesia adalah…..
a. Ekonomi rakyat semakin meningkat        c. Rakyat menderita dan banyak kematian
b. Hubungan antar daerah semakin lancar        d. Penjualan hasil bumi rakyat bertambah lancar
25.    Dalam upaya menyederhanakan upacara di Keraton Yogyakarta dan Surakarta DEANDELS banyak mendapat hambatan karena…..
a. Tidak mendapat restu dari raja            c. Tradisi keraton sudah berlaku turun menurun
b. Deandels diserang oleh raja Mataram        d. Tradisi baru sulit ditiru
26.    Pelaksanaan politik etis didasrakan atas Trilogi yang diusulkan oleh…..
a. Van Deventer        b. Max Havelaar    c. Dauwes Dekker    d. Multa Tuli
27.    Berikut raja-raja Aceh yang menentang Portugis kecuali…..
a. Sultan Iskandar Muda                c. Sultan Baabullah
b. Sultan Alaudin Riayat Syah            d. Sultan Ali Mughayat Syah
28.    Dalam menghadapi raja Kerajaan Banten, VOC menggunakan politik…..
a. Benteng Stelsel        b. Devide et Impera    c. Pintu terbuka        d. Perang terbuka
29.    Agama Kristen Protestan menjadi agama resmi negara Belanda menggantikan agama…..
a. Islam            b. Orthodox        c. Katholik        d. Budha
30.    Trilogi VAN DEVENTER meliputi tiga sector yaitu…..
a. Emigrasi, Irigasi dan Edukasi            c. Transmigrasi, Irigasi dan Edukasi
b. Migrasi, Irigasi dan Edukasi            d. Imigrasi, Irigasi dan Asosiasi
31.    Kongres Budi Utomo yang pertama dilaksanakan di kota…..
a. Jakarta            b. Bandung        c. Surabaya        d. Yogyakarta

32.    Pendiri organisasi nasional PNI adalah…..
a. Muhammad Hatta    b. Dr. Sutomo        c. Ir. Soekarno        d. Sutan Resayongan
33.    Secara psikologis sebab utama terjadinya penyimpangan sosial dari unsure pribadi manusia adalah adanya…..
a. Kepribadian ganda    b. Kepribadian rusak    c. Kepribadian utuh    d. Kepribadian menyimpang
34.    Pola penyimpangan dalam masyarakat yang hanya dilakukan seseorang tanpa melibatkan orang lain dalam masyarakat digolongkan dalam jenis penyimpangan…..
a. Individual        b. Campuran        c. Kelompok        d. Beriringan
35.    Pelaku penyimpangan sosial yang disebabkan efek konsumsi minuman keras termasuk terkena penyakit sosial berjenis…..
a. Alcoholic        b. Psikopat        c. Alkoholisme        d. Pedofilia
36.    Badan nasional Indonesia yang mengkoordinasikan mengatur sangsi bagi pihak pengedar narkoba adalah…
a. Granat            b. DNN            c. KPK            d. BNN
37.    Bagi orang yang sakit, obat-obatan merupakan kebutuhan…..
a. Primer            b. Sekunder        c. Tersier        d. Sekarang
38.    Perhatikan barang-barang berikut ini!
1) Buku            3) Gula            5) Air pada waktu hujan
2) Sinar matahari        4) Udara        6) Televisi
Berdasarkan data diats yang merupakan benda ekonomi adalah nomor…..
a. 1), 2) dan 3)        b. 1), 3) dan 6)        c. 2), 4) dan 5)        d. 2), 3) dan 6)
39.    Sumber daya perlu dihemat penggunaannya karena…..
a. Semua barang langka                c. Jumlahnya terbatas
b. Berupa kebutuhan manusia            d. Harganya tidak terjangkau
40.    Koperasi yang berusaha dalam bidang penyediaan barang-barang kebutuhan sehari-hari disebut koperasi….
a. Jasa            b. Produksi        c. Konsumsi        d. Pemasaran
41.    Badan usaha milik negara didirikan oleh…..
a. Swasta            b. Pemerintah        c. Koperasi        d. Pengusaha
42.    Tujuan utama koperasi adalah…..
a. Berdasarkan kekeluargaan            c. Mencari keuntungan
b. Meningkatkan kesejahteraan anggota        d. Menyerap tenaga kerja
43.    Salah satu ciri yang menonjolkan dalam pasar konkret adalah…..
a. Penjual dan pembeli berkontak langsung        c. Transaksi bisa lewat internet
b. Tidak memerlukan tempat khusus        d. Harga dapat berubah-ubah sewaktu-waktu
44.    Menurut sifat atau wujudnya pasar dibagi menjadi…..
a. Abstrak dan tidak nyata                c. Harian dan nyata
b. Abstrak dan konkret                d. Abstrak dan modal
45.    Perusahaan-perusahaan yang bergerak dalam bidang cabang-cabang produksi yang penting dan menguasai hajat hidup orang banyak di Indonesia dikuasai oleh…..
a. Pihak swasta        b. Negara        c. Koperasi        d. Umum