EVALUASI BELAJAR SEMESTER GENAP T.P 2019 / 2020 MATA PLEJARAN : IPS KELAS/SEMESTER : VIII / GENAP

EVALUASI BELAJAR SEMESTER GENAP
T.P 2019 / 2020

MATA PLEJARAN : IPS
KELAS/SEMESTER : VIII / GENAP

PILIHLAH JAWABAN A, B, C, ATAU D YANG KAMU ANGGAP BENAR!
1. Perhatikan nama-nama berikut!
1) Ir. Soekarno 3) A.A. Maramis 5) H. Agus Salim
2) Abdul Latif 4) Mr. Muh. Yamin 6) Prof. Dr. Soepomo
Tokoh-tokoh yang termasuk dalam panitia Sembilan adalah…..
a. 1), 2), 3) dan 4) b. 1), 2), 5) dan 6) c. 1), 3), 4) dan 5) d. 2), 3), 4) dan 5)
2. Salah satu agenda dalam siding PPKI tanggal 18 AGustus 1945 adalah…..
a. Penetapan bentuk negar a c. Penyusunan anggaran dasar
b. Pembentukan MPRS c. Pemilihan Presiden dan wakil presiden
3. Para pemuda menemui Bung Karno dan Bung Hatta. Setelah mendengar bahwa Jepang menyerah kepada sekutu pada tanggal 15 Agustus 1945. Pada saat itu, tanggapan Bung Karno adalah…..
a. Segera memutuskan untuk memproklamasikan kemerdekaan
b. Segera mempersiapkan naskah proklamasi
c. Menghubungi laksamana Maida untuk berdiskusi
d. Tetap berpendapat bahwa Jepang masih berkuasasecara De Facto
4. Proklamasi Kemerdekaan Indonesia yang dilaksanakan pada tanggal 17 Agustus 1945 adalah saat yang tepat mengingat Indonesia dalam keadaan Vacuum Of Power adalah…..
a. Kekosongan kekuasaan c. Kekalahan Jepang
b. Kekurangan tentara d. Kekuatan yang memuncak
5. Mengapa terjadi pertempuran di berbagai daerah pada awal kemerdekaan…..
a. Bangsa Indonesia suka berperang c. Penjajah ingin mempertahankan kekuasaannya
b. Tidak ada rasa persatuan di kalangan rakyat d. Proklamasi tidak didukung oleh seluruh rakyat
6. Pada awal terbentuknya RI, lembaga yang melaksanakan tugas MPR adalah…..
a. KNIP b. BKR c. PPKI d. BPUPKI
7. Pengesahan dan penetapan UUD 1945 serta pemilihan Presiden dan Wakil Presiden merupakan keputusan dalam siding…..
a. PPKI tanggal 18 Agustus 1945 c. PPKI tanggal 22 Agustus 1945
b. PPKI tanggal 19 AGustus 1945 d. BPUPKI tanggal 18 Agustus 1945
8. Hasrat berproduksi mendorong seseorang melakukan hubungan sosial karena…..
a. Mampu meneruskan keturunan dari generasi ke generasi berikutnya
b. Hanya dengan berhubungan sosial seseorang mengenal lawan jenisnya yang akan
mengantarkannya ke perkawinan
c. Ingin dicintai oleh lawan jenisnya
d. Dengan hubungan sosial seseorang mendapatkan sahabat
9. Berikut ini yang termasuk hubungan sosial antar kelompok adalah…..
a. Seorang polisi menilang seorang pengendara sepeda motor
b. Rapat antara pihak sekolah dengan wali murid guan menentukan besar uang gedung
c. Kepala sekolah memimpin rapat guru
d. Massa mengeroyok seorang pencuri
10. Akomodasi merupakan hubungan sosial yang bersifat positif karena…..
a. Mengumpulkan banyak pihak
b. Menyelesaikan pertentangan tanpa menghancurkan pihak lawan
c. Mengajak anggota masyarakat untuk berempati dan bertoleransi
d. Memicu munculnya konflik antar kelompok
11. Berikut ini yang termasuk hubungan sosial disosiatif adalah…..
a. Aksi demo menolak harga BBM berakhir dengan kerusuhan
b. Perkawinan campuran antar warga asing
c. Kerja bakti menyambut hari kemerdekaan Indonesia
d. Gotong royong menanam padi disawah
12. Hadirnya pihak keluarga sebagai penasihat dalam perselisihan merupakan karakteristik dari…..
a. Abitration b. Coersion c. Mediator d. Conciliation
13. Salah satu faktor yang menyebabkan pranata sulit mengalami perubahan adalah…..
a. Internalisasi dan pengendalian sosial c. Instituonalisasi dan tipifikasi
b. Interaksi dan sosialisasi d. Habitualisasi dan tipifikasi
14. Andika mendapat peringatan keras dari kepala sekolah karena sering membolos pada jam pelajaran Matematika. Apabila dilihat dari cakupannya pengendalian sosial diatas berupa pengawasan…..
a. Antar Individu c. Individu terhadap kelompok
b. Antar kelompok d. Kelompok antar individu
15. Cara pengendalian sosial yang dikemukakan pertama kali oleh Lapiere adalah…..
a. Sosialisasi b. Compulsion c. Koersif d. Tekanan sosial
16. Salah satu jenis pengendalian sosial pada masyarakat modern yang merupakan produk badan eksekutif adalah…..
a. Denda ulang b. Pencekalan c. Somasi d. Ganti rugi
17. Pihak yang paling menentukan kegiatan produktif suatu perekonomian adalah…..
a. Angkatan kerja b. Kesempatan kerja c. Usia kerja d. Tenaga kerja
18. Permintaan tenaga kerja sering juga disebut…..
a. Angkatan kerja b. Kesempatan kerja c. Usia kerja d. Pengangguran
19. Awalnya Nina bekerja di pabrik garmen, oleh karena krisis ekonomi berkepanjangan, pabrik garmen tempat Nina bekerja terpaksa melakukan PHK. Nina termasuk salah satu karyawan yang kena PHK dan akhirnya menganggur. Nina termasuk pengangguran…..
a. Musiman b.Friksional c. Struktural d. Siklikal
20. Pengangguran struktural terjadi karena…..
a. Resesi ekonomi yang sering terjadi c. Perubahan permintaan tenaga kerja secara berkala
b. Pertumbuhan ekonomi yang cepat d. Perubahan kondisi dan politik
21. Sektor usaha saat ini membutuhkan tenaga kerja yang siap pakai. Upaya pemerintah mengatasi hal tersebut dilakukan dengan cara…..
a. Menambah jumlah guru c. Membangun gedung-gedung sekolah
b. Melaksanakan program pendidikan dasar d. Memperbaiki kurikulum lebih apikatif
22. Perhatikan kegiatan-kegiatan yang dilakukan pemerintah berikut ini!
1) Pendidikan formal 3) Program padat karya 5) Mengurangi jumlah penduduk
2) Perbaikan gizi masyarakat 4) Pembinaan wirausaha
Cara pemerintah untuk memperbaiki mutu tenaga kerja ditunjukkan nomor…..
a. 1) dan 2) b. 2) dan 3) c. 3) dan 4) d. 4) dan 5)
23. Munculnya system ekonomi campuran disebabkan oleh…..
a. Adanya kebebasan dalam bersaing dan berusaha
b. Adanya kelemahan system ekonomi sosialis dan system liberal
c. Semakin banyaknya campur tangan pemerintah dalam perekonomian
d. Semakin banyaknya negara yang menerapkan system liberal
24. Kelemahan system ekonomi terpusat yaitu…..
a. Persaingan yang tidak sehat untuk mencapai kemakmuran
b. Monopoli sumber daya ekonomi oleh pemilik modal
c. Tidak ada kebebasan individu untuk berinisiatif
d. Mudah terjadi gejolak ekonomi
25. Pada system ekonomi liberal, masyarakat akan terbagi menjadi dua golongan yaitu…..
a. Pemodal dan pemerintah c. Pemodal dan buruh
b. Pemerintah dan buruh d. Tradisional dan modern
26. Dasar pelaksanaan system ekonomi Indonesia adalah UUD 1945 pasal…..
a. 32 b. 33 c. 34 d. 31
27. Salah satu ciri negative yang harus dihindari oleh system perekonomian Indonesia adalah…..
a. Potensi setiap masyarakat harus disalurkan kepada pemerintah
b. Tidak adanya perusahaan swasta dalam perekonomian
c. Kebebasan individu yang merugikan orang lain
d. Setiap warga negara mentaati peraturan pemerintah
28. Salah satu kelemahan system ekonomi di Indonesia adalah…..
a. Sangat besarnya peran pemerintah sehingga tidak ada inisiatif masyarakat
b. Terjadinya monopoli sumber ekonomi
c. Adanya perusahaan-perusahaan untuk negara
d. Adanya unit ekonomi kerakyatan yang berdasarkan azas kekeluargaan
29. Ketika melewati jalan tol, kebdaraan jalan tol harus membayar tiket. Sejumlah uang yang dikeluarkan pengguna jalan tersebut termasuk pembayaran…..
a. Pajak b. Iuran c. Retribusi d. Sumbangan
30. Pajak penghasilan (PPh) diatur dalam…..
a. Undang-undang Nomor 17 Tahun 2000 c. Undang-undang Nomor 12 Tahun 1985
b. Undang-undang Nomor 18 Tahun 2000 d. Undang-undang Nomor 12 Tahun 1994
31. Berikut ini beberapa macam pajak!
1) Pajak reklame 3) Pajak hotel 5) Bea Materai
2) Pajak ekspor 4) Pajak kendaraan bermotor
Dari keterangan diatas, yang termasuk pajak daerah adalah…..
a. 1), 2) dan 3) b. 1), 3) dan 4) c. 1), 3) dan 5) d. 2), 3) dan 4)
32. Permintaan suatu barang di pasar akan bertambah jika…..
a. Selera masyarakat tidak berubah c. Harga barng subtitusi menurun
b. Produksi barang beraneka ragam d. Harga barang subtitusi naik
33. Perhatikan faktor-faktor yang mempengaruhi permintaan berikut!
1) Penghasilan masyarakat bertambah 4) Selera masyarakat tidak berubah
2) Harga barang turun 5) Harga dimungkinkan naik pada masa depan
3) Harga barang pengganti turun
Faktor-faktor diatas yang menaikkan permintaan adalah…..
a. 1), 2) dan 3) b. 1), 3) dan 5) c. 1), 2) dan 5 d. 3), 4) dan 5)
34. Perhatikan table berikut ini!
Harga 1 Kg daging ayam Jumlah barang yang diminta (Kg)
Rp. 12.000,- 50
Rp. 13.000,- 40
Rp. 14.000,- 30
Rp. 15.000,- 20
Berdasarkan tabel tersebut, harga yang paling menguntungkan konsumen adalah…..
a. Rp. 12.000,- b. Rp. 13.000,- c. Rp. 14.000,- d. Rp. 15.000,-
35. P Harga (P) Kurva keseimbangan pada P1 terjadi jika…..
D a. Harga barang naik, jumlah barang naik
S b. Harga barang naik, jumlah barang turun
P1 c. Harga barang turun, jumlah barang naik
P2 E d. Harga barang turun, jumlah barang turun

S D
D Q1 Q2 Jumlah (Q)
36. Pada suatu pasar terjadi perubahan harga keseimbangan. Akibatnya, terjadi kelebihan permintaan terhadap penawaran, sehingga penjual kekurangan barang. Hal ini menyebabkan …..
a. Harga naik c. Jumlah barang ditambah
b. Harga turun d. Keuntungan penjual meningkat

37. Panglima tentara tertinggi jepang untuk kawasan Asia Tenggara berkedudukan di ….
a. Dalath c. Jakarta
b. Tarakan d. Bukittinggi
38. Berikut merupakan orang jepang yang menjadi anggota BPUPKI adalah ….
a. Kuniaki Kuiso c. Ichibangase
b. Tadashi Maeda d. Hideki Tojo
39. Siding pertama BPUPKI berlangsung ….
a. 28 Mei-1 Juni 1945
b. 28 Mei-2 Juni 1945
c. 29 Mei-1 Juni 1945
d. 29 Mei-7 Juni 1945

40. Ir. Soekarno pada masa persiapan kemerdekaan pernah menjabat sebagai ketua ….
a. Peta c. PPKI
b. KNIP d. BPUPKI
—- 0000 SELAMAT MENGERJAKAN 0000 —-
41. Pendapatan keluarga rumah tangga umumnya berasal dari….
a. Usaha sendiri dan gaji c. Usaha sendiri dan subsidi pemerintah
b. Warisan orang tua dan gaji d. Gaji dan subsidi pemerintah
42. Ciri-ciri rumah tangga keluarga yang mengkonsumsi barang/jasa secara rasional adalah…..
a. Tidak membeli barang/jasa sama sekali c. Membeli barang/jasa yang benar-benar dibutuhkan
b. Membeli seluruh barang/jasa yang ada d. Membeli barang/jasa yang sedang dibutuhkan
43. Suatu pasar yang dinamakan pasar konkret karena…..
a. Mendapat tempat usaha dan jasa-jasa penduduk
b.Kenyataannya terdapat orang, yaitu antar penjual dan pembeli
c. Dikelola oleh pemerintah daerah yang diikuti dengan retribusi
d. Kenyataannya di situ terdapat bermacam-macam barang yang diperjual belikan
44. Pendirian pasar modal, pembentukan badan pelaksana pasar modal dan pembentukan PT. Danaraksa sesuai dengan keputusan Presiden….
a. Nomor 50 tahun 1976 c. Nomor 52 tahun 1976
b. Nomor 51 tahun 1976 d. Nomor 53 tahun 1976
45. Pasar modal dan pasar tuna karya merupakan jenis dari pasar….
a. Daerah b. Harian c. Faktor produksi d. Distribusi
46. Organisasi pergerakan nasional Indonesia yang mengeluarkan manifesto politik tahun 1925 adalah…..
a. Indische Partij c. Partai nasional Indonesia
b. Perhimpunan Indonesia d. Partai Indonesia raya
47. Mengganti tanaman hutan yang rusak atau mati dengan tanama baru disebut…..
a. Rehabilitasi b. Reboisasi c. Penghijauan d. Intensifikasi
48. Segala kegiatan yang sifatnya menguntungkan negara akan dikelola oleh….
a. BUMS b. Koperasi c. BUMN d. Usaha dagang
49. Sifat keanggotaan koperasi Indonesia adalah…..
a. Sukarela b. Mengikat c. Demokratis d. Bebas

50. Koperasi yang kegiatannya menyediakan kebutuhan hidup sehari-haribagi para anggotanya adalah koperasi….
a. Konsumsi b. Serba usaha c. Simpan pinjam d. Produksi

EVALUASI BELAJAR SEMESTER GENAP TAHUN PELAJARAN 2019/2020 MATA PELAJARAN : IPS KELAS/SEMESTER : VIII/GENAP

EVALUASI BELAJAR SEMESTER GENAP
TAHUN PELAJARAN 2019/2020

MATA PELAJARAN : IPS
KELAS/SEMESTER : VIII/GENAP
1. Kebutuhan pokok manusia yang mutlak harus dipenuhi adalah…..
a. Primer b. Sekunder c. Tersier d. Premium
2. Salah satu cara untuk memenuhi kebutuhan yang akan datang adalah dengan cara…..
a. Bekerja b. Menabung c. Berkonsumsi d. Berproduksi
3. Sumber daya yang jumlahnya tidak dapat memenuhi kebutuhan maka dikatakan…..
a. Langka b. Punah c. Surplus d. Balance
4. Sebagai Homoeconomicus dalam memenuhi kebutuhan manusia selalu bersikap…..
a. Sosial b. Individu c. Kolektif d. Hemat
5. Berdasarkan bentuknya, peta yang tersimpan dalam disket, film dan hardisk termasuk…..
a. Peta biasa b. Peta timbul c. Peta umum d. Peta digital
6. Simbol yang digunakan pada denah atau sketsa terbatas dalam bentuk…..
a. Garis dan titik c. Wilayah dan titik
b. Warna dan wilayah d. Warna dan garis
7. Pengolahan tanah secara terasering berfungsi untuk mencegah…..
a. Kerusakan b. Hilangnya unsur hara c. Banjir d. Tanh longsor
8. Iklim maritim hanya terdapat atau terjadi di daerah…..
a. Dataran tinggi b. Pegunungan c. Kepulauan d. Daratan luas
9. Pengaruh budaya India yang tidak selaras dengan kehidupan sosial Indonesia adalah…..
a. Kelngsungan sistem pemerintahan kerajaan c. Berkembangnya seni bangunan candi
b. Diterapkannya peraturan sistem kasta d. Perkembangan bahasa dan tulisan Palawa
10. Kerajaan islam pertama di Indonesia adalah kerajaan…
a. Demak b. Aceh c. Mataram d. Samudra Pasai
11. Penjelajahan yang dilakukan oleh Magelhans mempunyai arti penting bagi ilmu pengetahuan sebab…..
a. Berhasil menemukan benua Asia
b. Berhasil menemukan daerah India
c. Mampu merangsang perkembangan IPTEK
d. Berhasil membuktikan teori bahwa bumi itu bulat
12. Contoh penggunaan lahan untuk kegiatan eknonomi yaitu untuk membangun…..
a. Rumah b. Masjid c. Sekolah d. Area tambak udang
13. 1) Sumber daya alam
2) Sumber daya manusia
3) Sumber daya modal
4) Sumber daya kewirausahaan
Dari sumber daya diatas, termasuk dalam faktor-faktor produksi adalah…..
a. 1), 2), 3) b. 1), 3) c. 2), 4) d. Semua benar
14. Kemampuan suatu perusahaan untuk memenuhi kewajiban jangka pendek dengan sejumlah aktiva lancarnya disebut…..
a. Solvabilitas b. Likuiditas c. Akuntabilitas d. Disposibilitas
15. Kemampuan untuk mencapai sesuatu yang baru disebut…..
a. Intuisi b. Imajinasi c. Kreativitas d. Inisiatif
16. Letak suatu wilayah berdasarkan susunan batuan yang ada pada bumi disebut…..
a. Astronomis b. Geologis c. Sejarah d. Historis
17. Tanah kering yang hanya ditumbuhi semak belukar disebut…..
a. Stepa b. Sabana c. Tanah humus d. Tanah lumut
18. Rasio ketergantungan adalah perbandingan antara jumlah…..
a. Penduduk tidak produktif dengan penduduk produktif
b. Penduduk belum produktif dengan penduduk produktif
c. Penduduk belum dan tidak produktif dengan penduduk produktif
d. Penduduk produktif dan belum produktif dengan penduduk tidak produktif
19. Upaya-upaya pemerintah berikut ini yang paling tepat untuk mengatasi masalah persebaran penduduk yang tidak merata di Indonesia adalah…..
a. Mencanagkan program KB c. Melaksanakan program transmigrasi
b. Meningkatkan pelayanan kesehatan d. Menggalakkan program WAJAR 9 Tahun
20. Undang-undang No. 23 Tahun 1997 mengatur tentang…..
a. Lingkungan hidup c. Sumber daya alam
b. Pengelolaan lingkungan hidup d. Pembangunan berkelanjutan
21. Kelompok makhluk hidup sejenis yang hidup dan berkembang biak pada suatu daerah disebut…..
a. Individu b. Komunitas c. Populasi d. Ekosistim
22. Deandles dikenal sebagai jenderal bertangan besi sebab…..
a. Arah kebijakannya difokuskan untuk membangun angkatan perang
b. Banyak membangun pabrik senjata dan mesin
c. Memerintah dengan keras dan kejam
d. Tidak memperhatikan kesejahteraan rakyat
23. Pada tahun 1512 bangsa Portugis mendarat di Indonesia dibawah pimpinan…..
a. Alfonso D’Albuquerque c. Marco polo
b. Cornelis De Houtman d. Kapten Sebastian del Cano
24. Trilogi VAN DEVENTER meliputi tiga sektor yaitu…..
a. Emigrasi, Irigasi dan edukasi c. Migrasi, Irigasi dan edukasi
b. Transmigrasi, Irigasi dan edukasi d. Imigrasi, Irigasi dan asosiasi
25. Pada awal berdirinya Budi tomo merupakan organisasi yang bergerak di bidang…..
a. Sosial dan ekonomi c. Pendidikan dan kebudayaan
b. Sosial dan politik d. Sosial dan budaya
26. Penyimpangan yang dilakukan secara terus menerus disebut penyimpangan…..
a. Primer b. Sekunder c. Individu d. Campuran
27. Tujuan pencegahan penyimpangan sosial perlu melibatkan peran….
a. Keluarga masyarakat dan pengusaha c. Keluarga sekolah dan pejabat pemerintah
b. Keluarga masyarakat dan sekolah d. Sekolah masyarakat dan pejabat pemerintah
28. Obat bagi orang sakit tergolong kebutuhan…..
a. Masa depan b. Sekarang c. Rohani d. Sekunder
29. Barang yang keberadaannya terbatas sehingga diperlukan pengorbanan untuk mendapatkannya disebut barang…..
a. Bebas b. Ekonomi c. Produksi d. Konsumsi
30. Adanya BUMN merupakan monopoli oleh pemerintah, hal ini diperbolehkan karena….
a. Menurunkan pendapatan c. Menguntungkan rakyat banyak
b. Merugikan rakyat banyak d. Menguntungkan pihak swasta
31. Pasar yang memperdagangkan barang-barang industri dalam negeri disebut pasar…..
a. Setempat b. Daerah c. Nasional d. Internasional
32. Selama pelaksanaan pembangunan telah terbukti bahwa peranan pasar terhadap kesejahteraan masyarakat sangat besar. Hal ini karena…..
a. Mengurangi kriminalitas c. Mengurangi pengangguran
b. Menyerap tenaga kerja d. Meningkatkan sumber pendapatan
33. Faktor utama yang menyebabkan Jepang menyerah pada sekutu adalah…..
a. Indonesia menuntut agar segera diberi kemerdekaan
b. Italia dan Jerman tidak mamu membantu Jepang
c. Dibomnya kota Hiroshima dan Nagasaki
d. Desakan dari Amerika Serikat untuk segera menyerah
34. Tujuan Jepang menyerang pangkalan militer Amerika Serikat di Pearl Harbour adalah…..
a. Untuk mempermudah Jepang dalam menguasai Australia
b. Melemahkan kekuatan Amerika Serikat karena dianggap sebagai penghalang rencana Jepang
c. Membebaskan bangsa-bangsa di kawasan pasifik dari pengaruh bangsa barat
d. Sebagai balasan terhadap serangan Amerika Serikat atas Hiroshima dan Nagasaki
35. Tujuan Jepang membentuk gerakan 3. A adalah…..
a. Mengakui keberadaan negara Indonesia c. Mendapatkan kepercayaan rakyat
b. Melatih orang Indonesia berorganisasi d. Menanamkan semangat nasionalisme
36. Proklamasi kemerdekaan Indonesia yang dilaksanakan tanggal 17 Agustus 1945 adalah saat yang tepat, mengingat Indonesia dalam keadaan Vacuum of Power. Arti Vacuum of Power adalah…..
a. Kekosongan kekuasaaan c. Kekalahan Jepang
b. Kekurangan tentara d. Kekuatan yang memuncak
37. Tempat penyusunan naskah proklamasi adalah rumah….
a. Jenderal Kaiso b. Laksamana Maeda c. Soekarno d. Ahmad Soebarjo
38. Keadaan Jepang semakin terjepit dengan dijatuhkannya bom atom di kota…..
a. Tokyo b. Dalath c. Canton d. Hiroshima
39. Presiden dan wakil presiden yang pertama adalah Ir. Soekarno dan Drs. Moh. Hatta yang disahkan oleh…..
a. Majelis Permusyawaratan Rakyat c. Hasil Pemilihan Umum
b. Dasar Kesepakatan seluruh Rakyat d. Panitia Persiapan Kemerdekaan Indonesia
40. Syarat terjadinya Interaksi sosial salah satunya adalah…..
a. Kontak dan toleransi c. Kontak dan hubungan sosial
b. Kontak dan komunikasi d. Interaksi dan kerjasama
41. Usaha meredakan ketegangan atau pertentangan untuk mencapai kestabilan merupakan bentuk interaksi…..
a. Asimilasi b. Asimilatif c. Akomodasi d. Kempetisi
42. Pranata sosial meupakan suatu sistem pola-pola pemikiran dan pola perilaku yang terwujud melalui…..
a. Situasi kehidupan c. Aturan perilaku
b. Adat istiadat d. Aktivitas kemasyarakatan
43. Untuk menanamkan sikap sopan santun terhadap anak diperlukan pranata…..
a. Perkawinan b. Ekonomi c. Peradilan d. Pendidikan
44. Tujuan utama tindakan yang dilakukan individu untuk mengendalikan diri adalah agar tidak menimbulkan…..
a. Penindasan antar masyarakat c. Konflik yang lebih luas
b. Imperialisme bru d. Degradasi lingkungan
45. Pengendalian sosial berupa pencegahan sebelum terjadi penyimpangan sosial merupakan bentuk pengendalian sosial…..
a. Preventif b. Kuratif c. Represif d. Normatif
46. Usaha pemerintah yang dilakukan agar dapat memperluas kesempatan kerja adalah…..
a. Pengembangan industri padat modal c. Menambah jumlah sekolah
b. Pengembangan industri padat karya d. Menambah kursus-kursus
47. Masalah ketenagakerjaan di Indonesia diatur dalam UUD 1945 pasal…..
a. 23 b. 27 c. 33 d. 34
48. Pemerintah dan swasta mempunyai peranan yang berimbang dalam kegiatan ekonomi adalah ciri sistem ekonomi…..
a. Terpusat b. Campuran c. Liberal d. Tradisional
49. Apabila wajib pajak menghitung sendiri pajak yag harus dibayarnya, maka sistem pemungutan pajak yang dipakai adalah…..
a. Self assesment system c. Semi self assesment system
b. Official assesment system d. With holding system
50. Hukum permintaan berbanding terbalik dengan harga artinya…..
a. Jika harga naik, permintaan turun c. Jika harga naik, penawaran tetap
b. Jika harga naik, permintaan naik d. Jika harga turun, permintaan tetap
KUNCI JAWABAN
1. A
2. B
3. A
4. D
5. D
6. A
7. D
8. C
9. B
10. D
11. D
12. D
13. D
14. B
15. C
16. B
17. A
18. C
19. C
20. B
21. C
22. C
23. A
24. C
25. C
26. A
27. C
28. B
29. B
30. C
31. C
32. D
33. C
34. B
35. C
36. A
37. B
38. D
39. D
40. B
41. C
42. D
43. D
44. C
45. A
46. B
47. B
48. B
49. A
50. A

EVALUASI BELAJAR SEMESTER GENAP MATA PELAJARAN : IPS KELAS/SEMESTER : VIII/ GENAP

EVALUASI BELAJAR SEMESTER GENAP
MATA PELAJARAN : IPS
KELAS/SEMESTER : VIII/ GENAP

1. Gambaran tentang seluruh atau sebagian permukaan bumi pada bidang datar dengan skala tertentu disebut…..
a. Peta b. Globe c. Sketsa d. Geografi
2. Negara Indonesia terkenal dengan sebutan negara agraris, pernyataan tersebut menunjukkan bahwa…..
a. Kebanyakan masyarakat Indonesia hidup sebagai petani
b. Hampir seluruh masyarakat bermata pencaharian sebagai pedagang
c. Sebagian besar wilayah Indonesia berupa daratan
d. Mata pencaharian penduduk Indonesia kebanyakan sebagai pelaut
3. Unsur alam yang tidak bisa digambarkan pada sebuah peta yaitu…..
a. Laut b. Dataran rendah c. Pegunungan d. Udara
4. Pengolahan tanah secara terasiring berfungsi untuk mencegah…..
a. Kerusakan tanah c. Banjir
b. Hilangnya unsur hara d. Tanah longsor
5. Agama Hindu masuk ke Indonesia melalui…..
a. Perdagangan b. Penaklukan c. Peperangan d. Pemaksaan
6. Letak Indonesia berdasarkan garis lintang dan garis bujur termasuk dalam penentuan letak…..
a. Geografis b. Klimatologis c. Astronomis d. Geologis
7. Dibawah ini yang merupakan aspek kimiawi yang berkaitan dengan sifat tanah subur adalah…..
a. Cukup mengandung unsur air c. Banyak mengandung unsur hara
b. Struktur tanahnya baik d. Pemanfaatannya sangat optimal
8. Kemampuan penduduk dalam memenuhi kebutuhan utamanya disebut…..
a. Kualitas penduduk c. Mobilitas penduduk
b. Kuantitas penduduk d. Aktifitas penduduk
9. Jumlah penduduk Indonesia pada tingkat dunia peringka ke…..
a. 2 b. 3 c. 4 d. 5
10. Pembangunan kota modern dengan seluruh aspek penunjangnya akan menciptakan kondisi lingkungan…..
a. Abiotik b. Budaya c. Alam d. Sosial
11. Aktifitas manusia dalam mengolah tanah secara serampangan akan mengakibatkan gejala yang merugikan di bidang pertanian yaitu terbentuknya…..
a. Lahan kritis b. Lahan potensial c. Lahan optimal d. Lahan maksimal
12. Pelaksanaan politik etis didasarkan atas Trilogi yang diusulkan oleh…..
a. Van Deventer b. Max Havelar c. Douwes Dekker d. Multa Tuli
13. Sisi positif kebijakan ekonomi Raffles di Indonesia adalah…..
a. Rakyat bebas mengusahakan tanaman yang menguntungkan sesuai dengan ketrampilannya
b. Rakyat tidak lagi dibebani pajak
c. Seluruh masyarakat mendapat kopling tanah dari pemerintah
d. Pemerintah menyediakan bibit tanaman komoditi ekspor
14. Untuk melumpuhkan Pangeran Diponegoro, Belanda menggunakan taktik…..
a. Benteng Stelsel b. Blockode c. Pagar betis d. Devide et Impera
15. Gerakan rakyat yang timbul atas kepercayaan bahwa seorang tokoh akan datang untuk membebaskan orang dari segala penderitaan dan kesengsaraan disebut…..
a. Gerakan Samin c. Gerakan ratu adil
b. Gerakan keagamaan d. Gerakan wahabiah
16. Trilogi Van Deventer meliputi tiga sector yaitu…..
a. Emigrasi, Irigasi dan Edukasi c. Transmigrasi, Irigasi dan Edukasi
b. Migrasi, Irigasi dan Edukasi d. Imigrasi, Irigasi dan Asosiasi
17. Pendiri Sekolah kebangsaan TAMAN SISWA adalah…..
a. Kyai. Samanhudi c. Ki Hajar Dewantara
b. Moh. Syafei d. Danudirjo Setiabudi
18. Secara psikologis sebab utama terjadinya penyimpangan sosial dari unsur pribadi manusia adalah adanya…..
a. Kepribadian ganda c. Kepribadian utuh
b. Kepribadian rusak d. Kepribadian menyimpang
19. Pola penyimpangan dalam masyarakat yang hanya dilakukan seseorang tanpa melibatkan orang lain dalam jenis penyimpangan…..
a. Individu b. Campuran c. Kelompok d. Beriringan
20. Kebutuhan primer dibedakan dengan kebutuhan sekunder berdasarkan…..
a. Sifatnya c. Tingkat kepentingannya
b. Tujuan penggunaannya d. Waktu penggunaannya
21. Perhatikan barang-barang berikut ini!
1) Buku 3) Gula 5) Air pada waktu hujan
2) Sinar matahari 4) Udara 6) Televisi
Berdasarkan data diatas yang merupakan benda ekonomi adalah nomor…..
a. 1), 2) dan 3) b. 1), 3) dan 6) c. 2), 4) dan 5) d. 2), 3) dan 6)
22. Tujuan utama Koperasi adalah…..
a. Berdasarkan kekeluargaan c. Mencari keuntungan
b. Meningkatkan kesejahteraan anggota d. Menyerap tenaga kerja
23. Apabila penghasilan kecil, kita harus panda-pandai memilih kebutuhan yang perlu dipenuhi sehingga terjadi…..
a. Keseimbangan antara kebutuhan konsumsi dan penghasilan keluarga
b. Mengajukan penambahan gaji
c. Perlu peningkatan kesejahteraan
d. Mendahulukan kebutuhan yang terpenting
24. Salah satu ciri yang menonjol dalam pasar konkret adalah…..
a. Penjual dan pembeli berkontak langsung c. Transaksi bisa lewat internet
b. Tidak memerlukan tempat khusus d. Harga dapat berubah-rubah setiap waktu
25. Perusahaan-peruhaan yang bergerak dalam bidang cabang-cabang produksi yang penting dan menguasai hajat hidup orang banyak di Indonesia dikuasai oleh…..
a. Pihak swasta b. Negara c. Koperasi d. Umum
26. Pada masa pendudukan Jepang terjadi perlawanan di berbagai daerah. Hal tersebut disebabkan karena…..
a. Kedatagan Jepang di Indonesia ditentang rakyat
b. Pejuang tahu bahwa posisi Jepang di dunia sulit
c. Para pejuang berusaha merebut kemerdekaan
d. Tindakan Jepang di Indonesia sudah diluar batas kemanusiaan
27. Jepang melakukan pemerasan tenaga manusia Indonesia untuk membangun berbagai sarana melalui…..
a. Kamikaze b. Harakiri c. Rodi d. Romusha
28. Proklamasi kemerdekaan Indonesia yang dilaksanakan tanggal 17 Agustus 1945 adalah saat yang tepat, mengingat Indonesia dalam keadaan Vacum Of Power arti dari Vacuum Of Power adalah…..
a. Kekosongan kekuasaan c. Kekalahan Jepang
b. Kekurangan tentara d. Kekuatan yang memuncak
29. Maksud naskah Proklamasi Kemerdekaan yang autentik adalah…..
a. Teks proklamasi tulisan tangan dari Ir. Soekarno
b. Teks yang diusulkan oelh Ahmad Subarjo dan Ir. Soekarno
c. Naskah yang diusulkan oleh Muhammad Hatta
d. Naskah yang diketik Sayuti Melik dan ditandatangani Soekarno Hatta
30. Keadaan Jepang semakin terjepit dengan dijatuhkannya bom atom di kota…..
a. Tokyo b. Dalath c. Canton d. Hiroshima
31. Persaingan yang sehat diantara klub basket untuk menjadi juara sifatnya…..
a. Asosiatif b. Asimilatif c. Kompetitif d. Komparatif
32. Pranata sosial merupakan suatu sistem pola-pola pemikiran dan pola perilaku yang terwujud melalui…..
a. Situasi kehidupan c. Aturan perilaku
b. adat istiadat d. Aktivitas kemasyarakatan
33. Untuk menanamkan sikap sopan santun terhadap anak diperlukan pranata…..
a. Perkawinan b. Ekonomi c. Peradilan d. Pendidikan
34. Secara umum proses awal pengendalian sosial tindakan yang digunakan merupakan tindakan…..
a. Kelompok b. Masyarakat c. Diri d. Lingkungan
35. Tujuan utama yang dilakukan individu untuk mengendalikan diri adalah agar tidak menimbulkan…..
a. Penindasan antar masyarakat c. Konflik lebih luas
b. Imperialisme baru d. Degradasi lingkungan
36. Masalah ketenaga kerjaan di Indonesia diatur dalam UUD 1945 pasal…..
a. 23 b. 27 c. 33 d. 34
37. Untuk menyerap banyak tenaga kerja maka dikembangkan usaha…..
a. Padat karya b. Padat modal c. Padat teknologi d. Padat informasi
38. Landasan perekonomian Indonesia ditentukan dalam…..
a. UUD 1945 pasal 33 c. Undang-Undang
b Pembukaan UUD 1945 d. Pancasila sila ke-4
39. Badan usaha yang didirikan oleh dua orang atau lebih dengan menggunakan nama bersama disebut…..
a. Firma c. Perseroan terbatas
b. Persekutuan d. Persekutuan Komanditer
40. Karcis masuk tempat wisata, iuran parkir, iuran sampah adalah contoh dari…..
a. Pajak b. Sumbangan c. Retribusi d. Iuran
41. Permintaan tercipta apabila pembeli memiliki…..
a. Keinginan membeli barang dan jasa yang diinginkan
b. Kesediaan membayar barang atau jasa yang dibelinya
c. Kesempatan bertemu dengan penjual
d. Keinginan membeli dan kesediaan membayar barang atau jasa yang dibelinya
42. Hukum permintaan berbanding terbalik dengan harga artinya…..
a. Jika harga naik permintaan turun c. Jika harga naik penawaran tetap
b. Jika harga naik permintaan naik d. Jika harga turun permintaan tetap
43. Harga keseimbangan mempunyai pengertian….
a. Harga yang ditetapkan pemerintah c. Harga yang diinginkan produsen
b. Harga yang diinginkan konsumen d. Harga yang terbentuk melalui mekanisme pasar
44. Harga barang yang naik dan diikuti oleh kenaikan jumlah barang yang ditawarkan adalah sesuai…..
a. Hukum ekonomi c. Hukum penawaran
b. Ceteris Paribus d. Hukum permintaan
45. Iuran yang dikenakan pada minyak tanah, bensin, minuman keras, rokok atau tembakau adalah…..
a. Pajak b. Sumbangan c. Retribusi d. Cukai
46. Suatu barang yang diperoleh dengan mengeluarkan biaya atau melakukan pengorbanan adalah termasuk barang……
a. Bebas b. Ekonomi c. Komplementer d. Substitusi
47. Salah satu ciri sistem demokrasi ekonomi yang harus dihindari adalah Free Fight Liberalisme yang artinya…..
a. Sebagian masyarakat tersingkirkan
b. Pemerintah tidak dapat mengawasi perekonomian
c. Adanya monopoli kelompok masyarakat tertentu
d. Menumbuhkan ekspoitasi manusia

48. Tokoh-tokoh berikut yang memberikan pendapatnya mengenai dasar-dasar Negara Indonesia, kecuali ….
a. Soeomo c. Ir. Soekarno
b. Moh. Hatta d. Muh. Yamin
49. Tokoh yang mendapatkan tugas mengetik naskah proklamasi adalah ….
a. Sukarni c. Sajoeti Malik
b. Moh. Hatta d. Ir. Soekarno

50. Tugas untuk membawa ir. Soekarno-Moh. Hatta ke Rengasdengklok dipercayakan pada ….
a. Singgih c. Chairul Saleh
Subeno d. Sutan Syahrir

EVALUASI BELAJAR SEMESTER GENAP MATA PELAJARAN : IPS KELAS/SEMESTER : VIII/ GENAP

EVALUASI BELAJAR SEMESTER GENAP
MATA PELAJARAN : IPS
KELAS/SEMESTER : VIII/ GENAP
1. Perhatikanperilakuberikutini:
1. Aldi sangatgiatmenabunguangjajannya
2. Beniselalumembolossetiap kali pelajaranmatematika
3. Rereadalahgadis yang sangatsopan
4. Mersa paling kuatTejoselalumelalakteman- temannya
Contohperilaku yang termasukdalampenyimpangan negative adalah…
a. 1 dan 2 b. 1 dan 3 c. 2 dan 4 d. 2 dan 3
2. Perhatikanhal – hal di bawahini:
1. Perkelahianantargeng
2. Penculikananak
3. Perjudian
4. Tawuranpelajar
5. Penyalahgunaannarkoba
Manakah yang termasukperilaku yang menyimpangdalamgayahidup yang berbeda…
a. 1,2, dan 3 b. 1,3, dan 4 c. 2,4, dan 5 d. 3,4, dan 5
3. Salah satuucapanpencegahanpenyimpangansosialdalamlinkungankeluargaadalah…
a. Menanamkanajaran agama sejakdiniketaatanberibadah
b. Membudayakanpelakudisiplinbahwawargamasyarakat
c. Mengembangkanberbagaikegiatanwarga yang bersifatpositif
d. Mengembangkankerukunanantarwargamasyarakat
4. Contohsikapsimpatimasyarakat yang dapatdikembangkanterhadap para pelakupenyimpangsosialadalah…
a. Menggaliinformasitentangbakat yang di miliki para pelakupenyimpang
b. Memberikanbantuandanasemampukita agar tidakmelakukankejahatan
c. Menghormatikebebasan para pelakupenyimpangsosial
d. Bersikaptoleransiterhadaptindakpenyimpang
5. Hal terpentingdalamupayamencegahpelakupenyimpangberupahubunganseksual di luarnikahadalah…
a. Mengekangpergaulanremaja c. Memperketatlembaga sensor film
b. Menghukumberatbagi para pelakunya d. Memperkuatkesadaranakannorma agama dansusila
6. Tidaktahanmenanggungpermasalahandalamhidupnya. Alan terlibatdalamduniaobat –obatanterlarang. MenurutcasareLembraso, penyimpangan yang di lakukan Alan di dorongolehfaktor….
a. Psikologis b. Fisiologis c. Biologis d. Sosiologis
7. Salah satufaktorpenyebabterjadinyakelangkaanadalah….
a. Tenaga kerja yang berkwalitas c.Kemajuanteknologilambat
b. Dayabelimasyarakatrendah d. Produk yang dihasilkanbanyak
8. Sumberdayabersipatterbatas. Usaha manusiauntukmengatasihaltersebutadalah…
a. Tidakmenggunakansumberdaya c. Mencarialternatifsumberdaya
b. Menekankebutuhan d. Mengurangipemanfaatansumberdaya
9. Sesuatu yang diinginkanmanusiadanharusdipenuhimerupakan……
a. Keinginan b. Kebutuhan c. Tindakanekonomi d. Kegiatankosumsi
10. Seorangpenguasaakanmempunyaikebutuhanlebihbanyakdibandingkandengantukangbangunankarena…
a. Pengusahalebihlebih kaya daripadatukangbangunan
b. Tingkat penghasilanpengusahalebihtinggidaripadatukangbangunan
c. Tingkat kepuasantukangbangunansangatrendah
d. Tingkat kepuasanpengusahalebihtinggi
11. Salah satutujuanmenetapkanskalaprioritaskebutuhanadalah…
a. Mengeluarkanlebihbanyakuang
b. Bersikaphidupboros
c. Menyesuaikankebutuhandenganpenghasilan
d. Membelibarangmelebihikebutuhan
12. Kebutuhan yang berkaitandengankelangsunganhidupmanusiaadalahkebutuhan…
a. Primer b. Jasmani c. Tersier d. Sekunder
13. PT. Pertaminadidirikandandikelolapemerintahdengantujuan …
a. Mencegahmonopoliswsta c. Mencarikeuntuangansebesar – besarnya
b. Mempermudahpenyediaan modal d. Memenuhikebutuhanbahanbakarminyak
14. Kopersiadalahusaha yang bertujuan…
a. Mencapaitingatkemakmuran
b. Meningkatkantarafhidupdankesajahteraananggota
c. Menentang system perekonomianbebasuntukmemupukkeuntungan
d. Menanamkankesadaranberkepribadianberdasarkanazazkekeluargaan
15. Berikutinimerupakanciri – cirikoperasiIndanesiaadalah…
a. Kumpulan modal
b. Koperasi Indonesia bekerjasamakarenapersamaankeuntungan
c. Kumpulan orang – orang
d. Segalakegiatan di laksanakaataspetunjukpengawas
16. Berikutini yang terkaitdenganpengertianpasarsecarasederhanaadalah….
a. Bertemunyapembelidanpenjualmelaluiperantara
b. Hanyamenyediakancontohbarang
c. Lebihmenekanpadaintekrasiantarapermintaandanpenawaran
d. Barang yang di perdagangkanharusberda di tempat

17. Pungutanresmidaripemerintahkepadapihak yang menjualprodukkeluarnegeriadalah ….
a. Cukai c. Bea impor
b. Bea materai d. Bea ekspor
18. Dalam hokum permintaan, factor yang memengaruhipermintaanadalah ….
a. Jumlah c. Pendapatan
b. Harga d. Teknologi
19. Permintaangelandanganterhadapmobil, termasukdalampermintaan …..
a. Efektif c. Absolute
b. Potensial d. Mutlak
20. Proses tawar-menawar yang terusmenerusakhirnyamembentuk ….
a. Hargapokok c. Hargasahabat
b. Hargapasar d. Hargadiskon

21. Pihak yang melakukankegiatanpermintaanadalah ….
a. Penjual c. Distributor
b. Pembeli d. Agen
22. Berikut yang termasukangkatankerjapotensialadalah ….
a. Guru c. Mahasiswa
b. Tukangkebun d. Pekerjakantin
23. Dalampengertianekonomi, pasarmemilikifungsisebagai…
a. Promosipembentukanharga, dandistrobusi
b. Interaksi, pembentukanharga, danpromosi
c. Distribusi, penjualandanpembelian
d. Pembentukanharga, penjualan, danpembelian

24. Di pasaranhanyaterdapatbeberapaprodusentelpongenggam. Dasartelpongenggam( HP) terbentuk…
a. Oligopoli b. Monopoli c. Persainganmonopolistik d. Persaingansempurna

25. Berikutinipernyataan yang benartentangpasarkongkritadalah…
a. Penjualdanpembelitidakbertemulangsung
b. Barang yang di perjualanbelikanhanyadalamsampel
c. Transaksimelalui media
d. Baranglangsung di serahkan

EVALUASI BELAJAR SEMESTER GENAP MATA PELAJARAN : IPS KELAS/SEMESTER : VIII/ GENAP

EVALUASI BELAJAR SEMESTER GENAP
MATA PELAJARAN : IPS
KELAS/SEMESTER : VIII/ GENAP

1. Tujuanpendiriansekolahbumiputraadalah…
a. realisasikehendakkaum liberal
b. mencetakpegawaiadministrasiBelanda yang terampil, murahdanterdidik
c. membebaskanrakyatdariketidakmampuan
d. menghasilkanpegawaiadministrasiBelanda yang bisamendudukijabatanpenting
2. Majalah Indonesia Merdeka diterbitkanolehperkumpulan……….
a. IndischePartij c. Perhimpunan Indonesia
b. Partai Nasional Indonesia d. Paartai Indonesia Raya
3. TujuanPemerintahKolonialBelandamendirikanpendidikankolonialadalahuntukmenghimpunrakyat Indonesia……….
a. Eksploitasikerja c. Mencegahrakyat Indonesia malasbekerja
b. Pemanfaatansumberdayatenaga d. Kebanyakanpegawaiterdidikdanterampil
4. ArtipentingSumpahPemudabagiperjuangandalammewujudkan Indonesia merdekaadalah …
a. Mendorongsemangatkesatuandanpersatuanbangsa
b. Meningkatkansemangatorganisasididaerah
c. Merupakan modal perjuangan di daerah-daerah
d. Mendorongpemudauntukmendirikanperkumpulan
5. PerhatianIndischePartijterhadappersatuannasional yang didasarisikaptoleransitampakdalam program…….
a. Menanamkancita-citapersatuan Indonesia
b. Memberantasketimpangannasional
c. Memperkuatpengaruh pro-Indonesia dalampemerintah colonial
d. Memperkuatpengaruh pro-Indonesia dalampemerintahkolonial
6. Dasardiambilnyabahasa Indonesia sebagaipersatuanadalah……………..
a. Bahasa Indonesia merupakanhasilbudayabangsa
b. Agar terciptanyasalingpengertiandalamperjuangan
c. Banyaknyabahasadaerah yang adadinusantara
d. Agar terciptanyapersatuandankesatuan
7. Lagu Indonesia Raya ditetapkansebagailaguKebangsaan Indonesia, Sang MerahPutih di tetapkansebagaiBendera Indonesia, haliniadalahhasil . . .
a. KongresPemuda I c. KongresPemuda III
b. KongeresPemuda II d. KongresPemuda IV
8. Perilakumenyimpang yang dilakukansecaraberkelompokadalahpenyimpangan yang komplekkarena…………
a. Kelompokmemilikinilai, norma, sikap, dantradisisendiri
b. Padakelompokjumlahindividunyabanyak
c. Kelompokmemilikikepribadian yang beragam
d. Kekuatanfisiknyalebihbesardaripadaindividu
9. Duahalpenting yang menjadipatokanapakahperilakuseseorangdianggapmenyimpangatautidakadalah…………
a. Norma-normaumumdansituasiumum yang berlangsung
b. Nilai-nilaidannorma-normasosial
c. Norma umumdantingkatpendidikanmasyarakat
d. ………………….
10. Sikap orang tuaterhadapanaknyasepertidibawahinikemungkinandapatmencegahprilakumenyimpangpadaremajayaitu …
a. Memenuhisegalaapa yang di mintaolehanaknya
b. Mengekangkebebasananak
c. Member kasihsayngdanperhatian yang memadai
d. Lebihmementingkankarierdaripadaanak
11. Kelangkaandalamilmuekonomiberarti …………..
a. Kondisialatpemuaskebutuhanterbatas, sedangkankebutuhanterbatas
b. Kondisidimanakebutuhanmanusiasesuaidengan alt pemuaskebutuhan
c. Kondisipemuaskebutuhanseimbangdengankebutuhanmanusia
d. Kondisikebutuhanmanusiaberkurangdanalatpemuaskebutuhantetap
12. Apabilaharga BBM naikmakaakibattarifangkutan juga naik, hubunganinidalamilmuekonomidinamakanhubungan …………
a. Phisikologis b. Ekonomi c. Sebabakibat d. fungsional
13. Kebutuhanadalah …
a. Semuabarangekonomiygdibutuhkansepanjangwaktu
b. Semuakeinginanuntukmendapatkankekayaandankepuasan
c. Semuakeinginanuntukmendapatkanbarangdanjasa
d. Semuakeinginanmanusia yang dirasamendesakuntukdipenuhi
14. Salah satuperanankoperasidalamkehidupanekonomibangsa Indonesia adalah …
a. Mengembangkan modal danmemperluasperusahaan
b. Membukakesempatankerjabagipengangguran
c. Memajukankemakmuranmasyarakatpadakhususnya
d. Berupayasecaraaktifmeningkatkankualitaskehidupanmasyarakat
15. Perhatikan data dibawahini !
1). Rumahtangga
2). Prmerintah
3). Perusahaan
4). Luarnegeri
Dalamperekonomiansedeerhanapelakuekonomiterdiriatas …………………..
a. 1) dan 3) b. 2) dan 4) c. 1) dan 2) d. 1) dan 4)
16. Badanusaha yang didirikanolehnegaradimanasebagianataukeseluruhanmodalnyaberasaldarinegaradisebut juga …
a. BUMS b. BUMD c. BUMN d. Koperasi
17. Menurutsifatwujudnya, pasardibagimenjadi…..
a. Pasarkonkritdanpasarabstrak c. Pasarabstrakdanpasartiban
b. Pasarabstrak, pasarbulanan, pasartahunan d. Pasarkonkrit da pasarharian
18. Berikutciri-ciripasarkonkritdanpasarabstrak.
1) Barang yang diperjualbelikannyata
2) Penjualdanpembelitidakbertemusecaralangsung
3) Transaksidilakukansecaratunai
4) Barangdapatdibawalangsung
5) Barang yang diperjualbelikanhanyadalambentuksampel
Urutan yang merupakanciripasarkonkretadalah…..
a. 1), 2) dan 3) b. 3), 4) dan 5) c. 1), 3) dan 4) d. 2), 3) dan 4)

19. Sifatkeanggotaankoperasi Indonesia adalah…..
a. Sukarela b. Mengikat c. Demokratis d. Bebas

20. Koperasi yang kegiatannyamenyediakankebutuhanhidupsehari-haribagi para anggotanyaadalahkoperasi….
a. Konsumsi b. Serbausaha c. Simpanpinjam d. Produksi
II. JAWABLAH PERTANYAAN-PERTANYAAN BERIKUT INI DENGAN BENAR!

51. Gariskhayal yang memisahkan fauna tifeaustralisdantifeperalihan di sebutgaris …………
52. Pencatatanpenduduk yang dilakukandenganmencatatpendudukberdasarkantempattinggal yang sesuaifaktaatautempattinggaltetapdisebut ……………………..
53. Semboyan yang mendorongbangsaEropadatangke Indonesia adalah …………………….
54. Sebutkanorganisasi-organisasinasionaltahun 1908 – 1920 !
55. Apasajasyarat-syaratsebuahpasar ?

SOAL IPS KELAS VIII SOAL PILIHAN BERGANDA

SOAL IPS KELAS VIII

SOAL PILIHAN BERGANDA

1. Apabila terjadi keadaan sumber daya yang ada, tidak cukup untuk memenuhi berbagai kebutuhan manusia, keadaan ini dinamakan ….
a. Kehilangan b. kekurangan c. kelangkaan d. Keterbatasan

2. Kebutuhan manusia akan makanan , minuman dan pakaian haruslah terpenuhi. Apabila kebutuhan tersebut tidak terpenuhi, kelangsungan hidup manusia akan terganggu. Kebutuhan hidup manusia yang harus terpenuhi ini disebut kebutuhan ….
a. Primer b. Sekunder c. tersier d. individu

3. Faktor – faktor yang mempengaruhi perbedaan kebutuhan seseorang dengan yang lain tersebut di bawah ini, kecuali …..
a. Keadaan alam b. agama dan kepercayaan c. adat istiadat d. Pendapatan

4. Berikut ini yang bukan penyebab kelangkaan alat pemenuhan kebutuhan adalah ……
a. Keterbatasan luas tanah c. luas dan kekayaan laut terbatas
b. Kesuburan tanah makin berkurang d. Kekurangan sinar matahari

5. Penjual kue rajin menjajakan dagangannya. Tukang kebun tekun merawat kebunnya . petani giat bekerja di sawah. Semua bentuk pekerjaan di atas dilakukan untuk …….
a. Mencari kebutuhan c. mencari kesenangan
b. Memenuhi panggilan tanah air d. Memenuhi kebutuhan hidup

6. Berikut ini termasuk pelaku utama perekonomian Indonesia kecuali …….
a. Bank b. Koperasi c. BUMN d. BUMS

7. Menyelenggarakan kemanfaatan umum berupa penyediaan barang atau jasa bagi kepentingan orang banyak merupakan ………..
a. Tujuan koperasi b. tujuan perusahaan c. salah satu tujuan BUMN d. Salah satu tujuan yayasan

8. Landasan konstitusional koperasi adalah ……
a. Pancasila b. UUD 1945 c. UU No 25 Tahun 1992 d. Pembukaan UUD 1945

9. Menjadi anggota koperasi tidak boleh dipaksakan atau ada unsur paksaan. Hal ini sesuai dengan prinsip koperasi
a. Keanggotaan bersifat suka rela c. pengelolaan dilakukan secara demokratis
b. Keanggotaan bersifat terbuka d. Keanggotaan koperasi bersifat sukarela dan terbuka

10. Simpanan yang harus dibayar sekali dengan jumlah besar yang sama, dibayar saat menjadi anggota koperasi merupakan sumber modal koperasi dari …….
a. Simpanan pokok b. simpanan wajib c. simpanan sukarela d. Dana cadangan

11. Tempat bertemunya penjual dan pembeli untuk melakukan transaksi jual beli barang atau jasa disebut …..
a. Toko b. pasar c. swalayan d. supermarket

12. Peranan pasar bagi konsumen yang utama adalah ……
a. Memperlancar arus barang c. memperkenalkan hasil produksi
b. Membuka kesempatan kerja d. Menyediakan barang yang dibutuhkan

13. Pasar Aviari, pasar Sagulung, Mega Mall, dan SP termasuk jenis pasar ……
a. Pasar Tradisional, Pasar Konsumsi, dan pasar Harian
b. Pasar Modern, pasar konsumsi, dan pasar harian
c. Pasar harian, pasar konsumsi, dan pasar konkrit
d. Pasar harian, pasar konsumsi, pasar abstrak.
e.

14. Perhatikan pernyataan berikut ini !
1. Jumlah penjual dan pembeli sama banyak
2. Pembelian barang melalui pesanan lebih dulu
3. Barang yang diperdagangkan homogen
4. Antara penjual dan pembeli tidak harus bertemu
5. Barang yang dibeli bisa langsung dibawa pulang
6. Barang yang diperdagangkan heterogen
Yang termasuk pasar konkrit ditunjukkan ….
a. 1,2 dan 3 b. 4,5 dan 6 c. 1,3 dan 5 d. 2,4 dan 6

15. Berikut ini yang bukan ciri – ciri makhluk sosial adalah ………
a. Individual dan egois c. setia kawan dan toleransi\
b. b. saling tolong menolong d. Simpati dan empati

EVALUASI BELAJAR SEMESTER GANJIL MATA PELAJARAN : IPS KELAS/SEMESTER : VIII/ GANJIL

EVALUASI BELAJAR SEMESTER GANJIL
MATA PELAJARAN : IPS
KELAS/SEMESTER : VIII/ GANJIL
1. Pusat timbulnya gempa bumi dinamakan…..
a. Episentrum b. Hiposentrum c. Tsunami d. Pleistosenta
2. Gempa yang terjadi di Aceh dan Daerah Istimewa Yogyakarta termasuk jenis gempa…..
a. Tektonik b. Vulkanik c. Terban d. Runtuhan
3. Ilmu yang mempelajari asal kejadian bumi struktur dan komposisinya disebut…..
a. Antropologi b. Geologi c. Sejarah d. Arkeologi
4. Berikut yang bukan merupakan bagian zaman batu adalah…..
a. Paleolitikum b. Mesolitikum c. Arkoikum d. Neolitikum
5. Sebagai Homoeconomicus dalam memenuhi kebutuhan manusia selalu bersikap…..
a. Sosial b. Individu c. Kolektif d. Hemat
6. Suatu proses yang dapat membantu individu melalui proses belajar dan penyesuaian diri agar ia dapat berperan dalam kelompoknya dinamakan proses…..
a. Adaptasi b. Sosialisasi c. mitasi d. Interaksi
7. Motif ekonomi sangat penting, sebab dapat…..
a. Mendorong semangat bekerja c. Menjadi pedoman kegiatan ekonomi
b. Menambah kewaspadaan d. Menjadi pedoman setiap tindakan
8. Peta yang digunakan bapak dan Ibu guru mengajar di kelas, berdasarkan bentuknya termasuk peta…..
a. Peta umum b. Peta digital c. Peta timbul d. Peta datar
9. Unsur alam yang tidak bisa digambarkan pada sebuah peta yaitu…..
a. Laut b. Dataran rendah c. Pegunungan d. Udara
10. Pengaruh Hindu-Budha dalam bidang politik dan pemerintahan terlihat pada…..
a. Pemerintahan yang berbentuk kerajaan c. Pemerintahan yang berbentuk kesultanan
b. Agama Hindu dijadikan agama negara d. Digunakan huruf pallawa dan bahasa sansakerta
11. Pengaruh budaya India yang tidak selaras dengan kehidupan sosial di Indoensia adalah…..
a. Berlangsungnyan sistem pemerintahan kerajaan
b. Ditetapkan peraturan sistem kasta
c. Berkembangnya seni bangunan candi
d. Berkembangnya bahasa dan tulisan pallawa
12. Kemampuan untuk menciptakan sesuatu yang baru disebut…..
a. Intuisi b. majinasi c. Kreativitas d. Inisiatif
13. Suatu tindakan untuk membuat perubahan-perubahan atas sesuatu yang sudah ada sekarang ini disebut…..
a. Inisiatif b. Inovasi c. Invensi d. Ekstensi
14. Kegiatan yang mendorong kreasi seseorang adalah…..
a. Bermain b. Bekerja c. Membaca d. Menonton
15. Letak Indonesia yang berdasarkan garis lintang dan garis bujur termasuk dalam penentuan letak…….suatu negara.
a. Geografis b. Klimatologis c. Astronomis d. Geologis

16. Pengertian garis lintang pada permukaan bumi yang paling tepat adalah…..
a. Garis khayal yang membagi wlayah Indonesia pada tiga daerah waktu
b. Garis khayal yang menghubungkan wilayah dengan letak ketinggian berbeda
c. Garus khayal yang membujur dari utara ke selatan
d. GAris khayal yang menghubungkan pada bola bumi yang melintang dari barat-timur secara horizontal
17. Pengertian penduduk Indonesia di bawah ini yang paling tepat ditunjukkan pada pernyataan…..
a. Semua orang yang berasal dari keluarga Indonesia
b. Semua orang yang sudah tinggal di ndonesia selama 3 bulan
c. Semua orang yang bertempat tinggal di wilayah Indonesia pada saat sensus dan menetap selama 6 bulan
d. Semua orang yang dilahirkan di Indonesia dan memperoleh akta kelahiran Indonesia
18. Kawasan hutan yang melindungi untuk mempertahankan atau melestarikan jenis flora tertentu agar dapat berkembang biak secara alami termasuk dalam upaya pelestarian lingkungan dengan menggunakan…..
a. Suaka margasatwa b. Kebun raya c. Taman safari d. Cagar alam
19. Kualitas penduduk berkaitan kondisi ekonomis masyarakat terlihat jelas manakala kita mengamati permasalahan…..
a. Tingkat penghasilan b. Tingkat pendidikan c. Tingkat kesehatan d. Mata pencaharian
20. Faktor nondemografi yang mempengaruhi pertumbuhan penduduk di bawah ini adalah…..
a. Pendidikan dan kesehatan c. Migrasi dan kelahiran
b. Penghasilan dan keterjangkauan d. Kematian dan imigrasi
21. Pengertian lingkungan hidup adalah…..
a. Kesatuan ruang dengan sebuah benda yang ada di permukaan bumi yang mempengaruhi kondisi
ekonomi masyarakat.
b. Kesatuan ruang dengan seluruh benda yang ada diseluruh muka bumi dan saling berkaitan dengan
aktivitas makhluk lain.
c. Kesatuan ruang dengan seluruh benda yang ada di seluruh muka bumi yang rentan terpengaruh banyak
perubahan dan modernisasi.
d. Kesatuan ruang dengan seluruh benda, daya, keadaan dan makhluk hidup termasuk manusia yang
mempengaruhi peri kehidupan dan kesejahteraan manusia serta makhluk hidup lain.
22. Perhatikan tabel komponen penyusun lingkungan berikut ini.
NO KOMPONEN NO KOMPONEN
1 Gravitasi 5 Atmosfer
2 Harimau 6 Tumbuhan
3 Sinar matahari 7 Iklim
4 Tundra 8 Bahan kimia
Lingkungan abiotik berdasarkan tabel diatas ditunjukkan pada komponen nomor…..
a. 1), 2), 3) dan 4) b. 5), 6), 7) dan 8) c. 1), 3), 5) dan 7) d. 2), 4), 6) dan 8)
23. Contour farming merupakan pola penanaman pada lahan pertanian dengan disesuaikan…..
a. Daerah aliran sungai b. Kemiringan terang c. Jumlah curah hujan d. Ketinggian tanah
24. Akibat pembuatan jalan Anyer sampai Panarukan bagi rakyat Indonesia adalah…..
a. Ekonomi rakyat semakin meningkat c. Rakyat menderita dan banyak kematian
b. Hubungan antar daerah semakin lancar d. Penjualan hasil bumi rakyat bertambah lancar
25. Dalam upaya menyederhanakan upacara di Keraton Yogyakarta dan Surakarta DEANDELS banyak mendapat hambatan karena…..
a. Tidak mendapat restu dari raja c. Tradisi keraton sudah berlaku turun menurun
b. Deandels diserang oleh raja Mataram d. Tradisi baru sulit ditiru
26. Pelaksanaan politik etis didasrakan atas Trilogi yang diusulkan oleh…..
a. Van Deventer b. Max Havelaar c. Dauwes Dekker d. Multa Tuli
27. Berikut raja-raja Aceh yang menentang Portugis kecuali…..
a. Sultan Iskandar Muda c. Sultan Baabullah
b. Sultan Alaudin Riayat Syah d. Sultan Ali Mughayat Syah
28. Dalam menghadapi raja Kerajaan Banten, VOC menggunakan politik…..
a. Benteng Stelsel b. Devide et Impera c. Pintu terbuka d. Perang terbuka
29. Agama Kristen Protestan menjadi agama resmi negara Belanda menggantikan agama…..
a. Islam b. Orthodox c. Katholik d. Budha
30. Trilogi VAN DEVENTER meliputi tiga sector yaitu…..
a. Emigrasi, Irigasi dan Edukasi c. Transmigrasi, Irigasi dan Edukasi
b. Migrasi, Irigasi dan Edukasi d. Imigrasi, Irigasi dan Asosiasi
31. Kongres Budi Utomo yang pertama dilaksanakan di kota…..
a. Jakarta b. Bandung c. Surabaya d. Yogyakarta

32. Pendiri organisasi nasional PNI adalah…..
a. Muhammad Hatta b. Dr. Sutomo c. Ir. Soekarno d. Sutan Resayongan
33. Secara psikologis sebab utama terjadinya penyimpangan sosial dari unsure pribadi manusia adalah adanya…..
a. Kepribadian ganda b. Kepribadian rusak c. Kepribadian utuh d. Kepribadian menyimpang
34. Pola penyimpangan dalam masyarakat yang hanya dilakukan seseorang tanpa melibatkan orang lain dalam masyarakat digolongkan dalam jenis penyimpangan…..
a. Individual b. Campuran c. Kelompok d. Beriringan
35. Pelaku penyimpangan sosial yang disebabkan efek konsumsi minuman keras termasuk terkena penyakit sosial berjenis…..
a. Alcoholic b. Psikopat c. Alkoholisme d. Pedofilia
36. Badan nasional Indonesia yang mengkoordinasikan mengatur sangsi bagi pihak pengedar narkoba adalah…
a. Granat b. DNN c. KPK d. BNN
37. Bagi orang yang sakit, obat-obatan merupakan kebutuhan…..
a. Primer b. Sekunder c. Tersier d. Sekarang
38. Perhatikan barang-barang berikut ini!
1) Buku 3) Gula 5) Air pada waktu hujan
2) Sinar matahari 4) Udara 6) Televisi
Berdasarkan data diats yang merupakan benda ekonomi adalah nomor…..
a. 1), 2) dan 3) b. 1), 3) dan 6) c. 2), 4) dan 5) d. 2), 3) dan 6)
39. Sumber daya perlu dihemat penggunaannya karena…..
a. Semua barang langka c. Jumlahnya terbatas
b. Berupa kebutuhan manusia d. Harganya tidak terjangkau
40. Koperasi yang berusaha dalam bidang penyediaan barang-barang kebutuhan sehari-hari disebut koperasi….
a. Jasa b. Produksi c. Konsumsi d. Pemasaran
41. Badan usaha milik negara didirikan oleh…..
a. Swasta b. Pemerintah c. Koperasi d. Pengusaha
42. Tujuan utama koperasi adalah…..
a. Berdasarkan kekeluargaan c. Mencari keuntungan
b. Meningkatkan kesejahteraan anggota d. Menyerap tenaga kerja
43. Salah satu ciri yang menonjolkan dalam pasar konkret adalah…..
a. Penjual dan pembeli berkontak langsung c. Transaksi bisa lewat internet
b. Tidak memerlukan tempat khusus d. Harga dapat berubah-ubah sewaktu-waktu
44. Menurut sifat atau wujudnya pasar dibagi menjadi…..
a. Abstrak dan tidak nyata c. Harian dan nyata
b. Abstrak dan konkret d. Abstrak dan modal
45. Perusahaan-perusahaan yang bergerak dalam bidang cabang-cabang produksi yang penting dan menguasai hajat hidup orang banyak di Indonesia dikuasai oleh…..
a. Pihak swasta b. Negara c. Koperasi d. Umum

EVALUASI BELAJAR SEMESTER GANJIL T.P 2019/2020 MATA PELAJARAN : IPS KELAS/SEMESTER : VIII/GANJIL

EVALUASI BELAJAR SEMESTER GANJIL
T.P 2019/2020

MATA PELAJARAN : IPS
KELAS/SEMESTER : VIII/GANJIL

1. Proses penyesuaian norma dan budaya seseorang dengan masyarakat disebut…..
a. Sosialisasi b. Inkulturisasi c. Integrasi d. Kulturisasi
2. Berusaha melakukan untuk memenuhi kebutuhan ekonomi merupakan ciri manusia sebagai berikut…..
a. Makhluk sosial c. Makhluk ekonomi
b. Makhluk sosial yang bermoral d. Makhluk ekonimi yang bermoral
3. Pengusaha dalam melaksanakan usahanya tidak semata-mata mengejar laba, tetapi juga memikirkan kesejahteraan karyawannya, berarti fungsi manusia sebagai…..
a. Makhluk sosial yang bermoral c. Makhluk ciptaan Tuhan
b. Makhluk ekonomi yang bermoral d. Makhluk sosial ekonomi yang bermoral
4. Untuk memenuhi kebutuhan hidupnya, manusia memerlukan kerjasama dengan…..
a. Sesama manusia b. Lingkungan sekitar c. Pemerintah d. Dirinya sendiri
5. Atlas yang menggambarkan keaadaan alam secara unum dan berhubungan dengan tata surya, galaksi, planet serta peredaran benda-benda angkasa termasuk atlas…..
a. Nasional b. Dunia c. Regional d. Semesta
6. Yang termasuk kegunaan peta umum yaitu untuk…..
a. Memperlihatkan persebaran pendduduk c. Menjelaskan hasil-hasil tambang
b. Menggambarkan perbedaan jenis tanah d. Menunjukkan letak suatu tempat
7. Fungsi peta umum sebagai alat peraga adalah…..
a. Menentukan letak tempat disuatu wilayah c. Menentukan jumlah penduduk suatu wilayah
b. Mengetahui keadaan cuaca suatu tempat d. Mengetahui perkembangn kota
8. Bumi berbentuk bulat, oleh karena itu penggambaran penampakan di permukaan bumi pada peta yang berbentuk datar memerlukan suatu system yang disebut…..
a. Proyeksi b. Distorsi c. Koordinat d. Pengukuran
9. Sebelum masuknya kebudayaan Hindia, masyarakat Indonesia menganut kepercayaan bahwa roh leluhur diwujudkan dalam bentuk binatang. Aliran kepercayaan semacam itu disebut…..
a. Animisme b. Dinamisme c. Totemisme d. Animetisme
10. Kerajaan aceh berkembang pesat setelah Malaka dikuasai oleh Portugis pada tahun…..
a. 1511 b. 1512 c. 1513 d. 1514
11. Bukti bahwa islam telah sampai di Indonesia pada abad ke VII Masehi didasarkan atas…..
a. Ditemukannya nisan dari desa Leran, Gresik
b. Dinasti Tang
c. Kenyataannya bahwa di Perlak semua penduduknya beragama Isalm
d. Batu nisan di Troloyo pada jaman Majapahit
12. Bumi tampak biru bila dilihat dari angkasa, Penampakan ini menunjukkan bahwa bumi…..
a. Diselubungi atmosfer c. Memiliki hutan yang luas
b. Sebagian besar permukaannya tertutup air d. Memantulkan sinar biru
13. Suhu udara yang paling dingin terdapat dilapisan…..
a. Troposfer b. Stratosfer c. Mesosfer d. Termosfer
14. Keadaan rata-rata cuaca di suatu daerah berdasarkan pengamatan dalam jangka waktu yang lama disebut…..
a. Angin b. Suhu c. Iklim d. Cuaca
15. Letak suatu negara ditinjau dari garis lintang dan garis bujurnya disebut…..
a. Letak geografis b. Letak geologis c. Letak nuster historis d. Letak Astronomis

EVALUASI BELAJAR SEMESTER GANJIL T.P 2019/2020 MATA PELAJARAN : IPS KELAS/SEMESTER : VIII/GANJIL

EVALUASI BELAJAR SEMESTER GANJIL
T.P 2019/2020

MATA PELAJARAN : IPS
KELAS/SEMESTER : VIII/GANJIL
PILIHLAH JAWABAN A,B,C.ATAU D YANG KAMU ANGGAP BENAR !

1. Pernyataan yang berhubungan dengan letak geografis Indonesia adalah….
a. Indonesia terletak di antara tiga lempeng tektonik
b. Wilayah Indonesia terletak di antara dua benua dan dua samudra
c. Indonesia berada pada daerah lintang rendah
d. Indonesia memiliki iklim tropis
2. Angin yang bertiup dari wilayah Asia menuju Australia ketika melewati Indonesia menyebabkan terjadinya musim….
a. Hujan b. Labuh c. Kemarang d. Kemarau
3. Berikut ini merupakan data yang dapat diperoleh dari piramida penduduk, kecuali….
a. Komposisi umur penduduk
b. Pemisahan kelompok penduduk laki-laki dan perempuan
c. Jumlah kelahiran dan kematian
d. Jumlah penduduk perkelompok umur
4. Masalah yang timbul dari usia kerja dengan lapangan kerja yang tersedia adalah….
a. Kurangnya golongan angkatan kerja yang terampil
b. Lapangan kerja yang tersedia tidak sesuai dengan keahliannya
c. Tidak seimbangnya lapangan kerja dengan jumlah tenaga kerja
d. Angkatan kerja sebagian besar hanya berpendidikan rendah
5. Salah satu upaya yang dapat ditempuh untuk mengurangi tingkat urbanisasi yaitu….
a. Mengadakan razia kepada pendatang c. Memperbaiki sarana transportasi menuju kota
b. Memperluas lapangan kerja kepada pendatang d. Melengkapi sarana hiburan di daerah tujuan
6. 1. Tumbuhan
2. Air
3. Hewan
4. Tanah
5. Manusia
6. Udara
Unsur-unsur abiotik penyusun lingkungan hidup adalah….
a. 1, 2 dan 3 b. 1,3 dan 5 c. 2, 4 dan 6 d. 4, 5 dan 6
7. Manakah pernyataan yang benar tentang lingkungan hidup di bawah ini….
a. Manusia dapat hidup tanpa hewan dan tumbuhan
b. Manusia membutuhkan lingkungan hidup untuk memenuhi kebutuhannya
c. Hewan tidak dapat hidup tanpa kehadiran manusia
d. Tumbuhan tidak dapat hidup tanpa kehadiran manusia

8. Berikut merupakan usaha-usaha pelestarian lingkungan hidup, kecuali…..
a. Melakukan daur ulang sampah c. Pembuatan terasiring pd lahan yg memiliki lereng curam
b. Penggunaan pupuk organic dalam pertanian d. Meningkatkan kegiatan industrialisasi
9. Usaha pelestarian flora dan fauna dapat dilakukan dengan….
a. Mengembangkanbiakkan hewan dan tanaman langka c. Memanfaatkan flora dan fauna secara bijaksana
b. Penggundulan hutan d. Berburu hewan langka
10. Salah satu satu ciri pembangunan berkelanjutan adalah….
a. Adanya perhatian terhadap kelestarian lingkungan
b. Adanya penggalian sumber tenaga alternatif
c. Meningkatkan peran serta masyarakat dalam pembangunan
d. Menghemat penggalian sumber daya alam
11. Faktor – faktor yang mempengruhi rendahnya pendapatan perkapita penduduk Indonesia adalah….
a. Pinjaman luar negeri digunakan untuk membiayai pembangunan
b. Teknologi modern telah digunakan di berbagai bidang pembangunan
c. Banyaknya penduduk tidak mau berwiraswasta
d. Pendapatan nasional yang tinggi
12. Permasalahan kependudukan akibat pertumbuhan penduduk yang tinggi adalah….
a. Kesejahteraan meningkat c. Jumlah pengangguran berkurang
b. Kemiskinan yang terus meningkat d. Pemukiman kumuh di perkotaan semakin berkurang
13. Akibat kebijakan Deandles menjadikan para penguasa wilayah sebagai pegawai pemerintah adalah…
a. Wewenang penguasa berkurang
b. Gaji penguasa feodal menjadi bertambah
c. Terjadi perubahan profesi secara besar – besaran
d. Para penguasa feodal beramai – ramai memilih menjadi pemerintah
14. Salah satu jasa Refles selama masa kekuasaan di Indonesia adalah….
a.Menulis buku Max Havelaar c. Membangun Taman Mini Indonesia Indah
b.Menulis buku The History Of Java d.Membangun istana merdeka
15. Sebab khusus terjadinya perang diponegoro adalah…
a. Dipersempitnya kekuasaan raja – raja di Jokjakarta
b. Golongan bangsawan dilarang menyewakan tanah
c. Rencana Belanda membuuat jalan yang menerobos tanah Pangeran Diponegoro
d. Berkembangnya kebudayaan barat yang bertentangan dengan agama Islam
16. Pelaksanaan sistem tanam di paksa di Indonesia ditunjukan untuk….
a. Memperkenalkan jenis tanaman Industri c. Memberikan pekerjaan penduduk pedesaan
b. Memanfaatkan tanah pertanian di Jawa d. Meningkatkan produksi ekspor
17. Akar permasalahan timbulnya pertawanan rakyat Bali adalah adanya….
a. Monopoli perdagangan c. Hak tawan kurang
b. Sistem tanam paksa d. Sistem sewa tanah
18. Misi para pendeta Belanda menyebarkan agama Kristen Protestan di Indonesia tergolong berhasil karena…
a. Mendapat sambutan baik c. Ajaranya sesuai dengan budaya Indonesia
b. Di dukung oleh pemerintah kolonial d. Berlangsung dengan damai
19. Emigrasi sebagai salah satu program politik etis yang di lakukan dengan cara…
a. Memenuhi kebutuhan tenaga kerja c. Mengurangi jumlah penduduk Jawa
b. Pemerataan jumlah penduduk Indonesia d. Menambah jumlah penduduk di luar Jawa
20. Dasar kebangsaan atau Nasionalisme pertama kali di gunakan oleh organisasi….
a. Budi Utomo c. Serikat islam
b. Muhamaddiyah d. Indische Partij
21. Faktor internal yang mendorong munculnya nasionalisme adalah….
a. Kemenangan Jepang atas Rusia dalam perang tahun 1905
b. Terjadinya pergerakan kebangsaan India
c. Gerakan Turki Wuda yang dipimpin Kewal Pasha
d. Munculnya kelompok cendikiawan alumni sekolah barat
22. Pemimpin Indische Partij yang di kenal dengan sebutan tiga serangkai adalah…
a. K.H Sumanhudi, Abdul wuis, dan Darsono
b. Semaun, Wr. Sahono, dan Darsono
c. Ir Soekarno, Moh Hatta, dan Suwardi Suryaningrat
d. Dowes Dekker, Suwardi Suryaningrat, dan Cipto Mangunkusumo
23. Salah satu faktor luar (external) yang mempengaruhi munculnya nasionalisme Indonesia adalah…
a. Lahirnya golongan terpelajar c. Kesengsaraan Bangsa Indonesia
b. Pergerakan Nasional di Cina d. Perasaan senasib seperjuangan
24. Serikat Islam berhasil menghimpun anggota yang besar karena…
a. Keanggotaanya terbuka c. Mendapat bantuan dari Negara Arab
b. Di dukung oleh negara- negara Islam d. Merupakan organisasi Islam yang pertama

25. Tipe tubuh tertentu lebih cenderung melakukan penyimpangan tipe- tipe tubuh lainya. Pernyataan ini merupakan salah satu isi dari teori:
a. Sosialisasi c. Anomi
b. Pemberian cap d. Biologis

ULANGAN TENGAH SEMESTER GANJIL TAHUN 2019/ 2020 Mata Pelajaran : Ilmu Pengetahuan Sosial Kelas / Semester : VI / Ganjil

ULANGAN TENGAH SEMESTER GANJIL TAHUN 2019/ 2020
Mata Pelajaran : Ilmu Pengetahuan Sosial
Kelas / Semester : VI / Ganjil
I Berilah tanda silang ( X ) pada huruf a,b,c atau d didepan jawaban yang paling tepat.
1. Pada awal proklamasi kemerdekaan Indonesia terdiri atas ……..Provinsi
a. 8 c. 10
b. 9 d. 11
2. Provinsi Daerah Istimewa Yogjakarta mendapatkan status keistimewaannya pada tahun………
a. 1945 c. 1960
b. 1950 d. 1970
3. Ibu kota wilayah Kepulauan Riau adalah ………
a. Pangkal Pinang c. Pekan baru
b. Tanjung Pinang d .Medan
4. Deklarasi Juanda diumumkan pemerintah Indonesia pada tanggal ……..
a. 2 Oktober 1960 c. 13 Desember 1957
b. 14 Pebruari 1957 d. 17 Agustus 1959
5. Indonesia terletak dua benua yaitu benua………
a. Eropa dan Australia c . Asia dan Eropa
b. Asia dan Afrika d. Asia dan Australia
6. Negara terkecil di kawasan Asia Tenggara adalah ……..
a. Brunai Darusalam c. Kamboja
b. Singapura d. Timur Leste
7. Hasil tambang yang terbesar di Malaysia adalah ………….
a. Besi c. Minyak bumi
b. Tembaga d. Timah
8.
NO NEGARA NO NEGARA
1
2
3 Mesir
Vietnam
Kolombia 4
5
6 Kamboja
Kanada
Thailand
Negara-negara di atas yang termasuk Negara Negara tetangga adalah ……..
a. 2, 4, 5 c. 2, 4, 6
b. 1, 2, 6 d. 1, 3, 6
9. Negara –negara tetangga berikut yang pemerintahanya berbentuk Kerajaan adalah……….
a. Singapura, Filipina, Thailand c. Malaysia, Singapura, Laos
b. Malaysia, Thailand d. Brunai Darusalam, Timor Timur, Miyanmar
10. Salah satu upaya yang dilakukan pemerintah Indonesia untuk mengatasi pertumbuhan penduduk yang tinggi adalah melalui program ……….
a. Keluarga Berencana c. Inpres Desa tertinggal
b. Transmigrasi d. Bantuan Langsung Tunai

II. Jawablah pertanyaan-pertanyaan dibawah ini dengan singkat dan jelas !

11. Salah satu Propinsi yang lepas dari wilayah NKRI adalah ….
12. Jumlah provinsi di Indonesia sampai saat ini adalah ….
13. Wilayah laut yang diukur dari garis pangkal sampai sejauh 200 mil laut kearah laut bebas disebut….
14. Negara tetangga yang paling dekat dengan wilayah kita adalah ….
15. Penggunaan bahan peledak maupun pukat harimau dalam menangkap ikan dilarang karena………..
16. Bentuk pemerintahan Negara Kamboja adalah ….
17. Organisasi kerja sama antar Negara Asia Tenggara disebut ….
18. Negara yang mendpatkan julukan Negara Gajah Putih adalah ….
19. Mata uang Negara Malaysia adalah ….
20. Letak batas wilayah dan nama propinsi di Indonesia dapat diketahui melalui ….

III. Jawablah pertanyaan-pertanyaan dibawah ini dengan uraian yang jelas dan tepat !

21. Sebutkan lima Provinsi yang terbentuk pada awal kemerdekaan !
…………………………………………………………………………………………………………………………………….
…………………………………………………………………………………………………………………………………….

22. Mengapa Negara Indonesia disebut negara maritim?
…………………………………………………………………………………………………………………………………….
…………………………………………………………………………………………………………………………………….
23. Bagaimana cara menjaga kelestarian laut ?
…………………………………………………………………………………………………………………………………….
…………………………………………………………………………………………………………………………………….
24. Sebutkan negara-negara anggota ASEAN!
…………………………………………………………………………………………………………………………………….
…………………………………………………………………………………………………………………………………….
25. Bagaimana cara mengatasi masalah-masalah kependudukan di Indonesia?

…………………………………………………………………………………………………………………………………….
…………………………………………………………………………………………………………………………………….

Kumpulan Soal Kurikulum 2013 SD SMP SMA Terlengkap